Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9X657

Protein Details
Accession S9X657    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
120-145SESMQKTEKFKKDRQKRNAQSEAPPLHydrophilic
NLS Segment(s)
PositionSequence
130-131KK
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MSVISKEVWNSFSVPLKKFLKKYPPETANTWSTKSDRINPFLPTRNPLNGVLRDPVYSNRRQADIYKEAKYHRLEHLIPQEMTWNKDSSRHILKGVLFPKGRIAERKREETLQNRQKKLSESMQKTEKFKKDRQKRNAQSEAPPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.37
3 0.43
4 0.49
5 0.51
6 0.56
7 0.59
8 0.61
9 0.67
10 0.69
11 0.69
12 0.66
13 0.66
14 0.63
15 0.59
16 0.54
17 0.49
18 0.41
19 0.37
20 0.38
21 0.37
22 0.41
23 0.39
24 0.41
25 0.41
26 0.42
27 0.46
28 0.48
29 0.46
30 0.41
31 0.39
32 0.37
33 0.37
34 0.36
35 0.36
36 0.3
37 0.3
38 0.28
39 0.25
40 0.23
41 0.21
42 0.24
43 0.24
44 0.24
45 0.27
46 0.26
47 0.27
48 0.27
49 0.29
50 0.29
51 0.33
52 0.34
53 0.32
54 0.33
55 0.33
56 0.37
57 0.38
58 0.34
59 0.28
60 0.29
61 0.27
62 0.3
63 0.35
64 0.33
65 0.31
66 0.28
67 0.31
68 0.27
69 0.28
70 0.25
71 0.2
72 0.16
73 0.21
74 0.23
75 0.23
76 0.29
77 0.28
78 0.27
79 0.3
80 0.31
81 0.33
82 0.33
83 0.35
84 0.28
85 0.27
86 0.31
87 0.32
88 0.33
89 0.35
90 0.38
91 0.41
92 0.47
93 0.53
94 0.51
95 0.52
96 0.57
97 0.56
98 0.62
99 0.62
100 0.65
101 0.62
102 0.62
103 0.6
104 0.58
105 0.56
106 0.54
107 0.55
108 0.52
109 0.56
110 0.62
111 0.64
112 0.66
113 0.69
114 0.68
115 0.66
116 0.68
117 0.71
118 0.74
119 0.79
120 0.84
121 0.86
122 0.87
123 0.9
124 0.91
125 0.86