Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9W270

Protein Details
Accession S9W270    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
27-51LTFHFLSVKKKSKKSSKSLKSAVESHydrophilic
NLS Segment(s)
PositionSequence
36-41KKSKKS
Subcellular Location(s) nucl 10.5, cyto_nucl 9.333, mito 8.5, cyto_mito 8.333, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR008999  Actin-crosslinking  
IPR010414  FRG1  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF06229  FRG1  
Amino Acid Sequences MPSRLSFKGDKKVYVELFDQIVSSRFLTFHFLSVKKKSKKSSKSLKSAVESQENDPIWTDAILMEDLHGPLVLYQRLDTTVISLGVEEVQGSCVGIFLDPLSLEPDNTRQVFVASDMNGNIVLKSFLLKYLSVGKEGDLFSRREAIGAEEQWVLEYLHDGYWAWKSMSNNKYLECLLNENDTYLFRCTSDTVTFTSKWRVRVQTRFLKRSSTQTIKKPTVHSEQLEAMAGRPLSAEEKKTLKQASKDGSLHEALLDLRVSKKSDKYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.44
3 0.36
4 0.34
5 0.29
6 0.25
7 0.18
8 0.18
9 0.15
10 0.14
11 0.12
12 0.11
13 0.12
14 0.18
15 0.18
16 0.21
17 0.26
18 0.29
19 0.34
20 0.43
21 0.53
22 0.55
23 0.61
24 0.67
25 0.71
26 0.77
27 0.82
28 0.84
29 0.84
30 0.85
31 0.85
32 0.82
33 0.76
34 0.74
35 0.69
36 0.66
37 0.58
38 0.5
39 0.5
40 0.43
41 0.39
42 0.33
43 0.28
44 0.2
45 0.17
46 0.15
47 0.07
48 0.08
49 0.08
50 0.07
51 0.07
52 0.08
53 0.08
54 0.08
55 0.07
56 0.06
57 0.06
58 0.1
59 0.1
60 0.09
61 0.09
62 0.1
63 0.11
64 0.12
65 0.11
66 0.09
67 0.1
68 0.1
69 0.09
70 0.08
71 0.08
72 0.07
73 0.07
74 0.05
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.03
85 0.04
86 0.04
87 0.05
88 0.07
89 0.07
90 0.07
91 0.08
92 0.11
93 0.15
94 0.15
95 0.15
96 0.12
97 0.13
98 0.13
99 0.13
100 0.13
101 0.1
102 0.1
103 0.1
104 0.1
105 0.09
106 0.09
107 0.08
108 0.05
109 0.05
110 0.04
111 0.05
112 0.05
113 0.06
114 0.07
115 0.07
116 0.08
117 0.15
118 0.16
119 0.16
120 0.16
121 0.15
122 0.17
123 0.18
124 0.19
125 0.14
126 0.14
127 0.13
128 0.16
129 0.16
130 0.13
131 0.13
132 0.13
133 0.13
134 0.13
135 0.15
136 0.12
137 0.12
138 0.12
139 0.12
140 0.09
141 0.07
142 0.07
143 0.06
144 0.06
145 0.06
146 0.06
147 0.06
148 0.08
149 0.09
150 0.09
151 0.11
152 0.13
153 0.22
154 0.26
155 0.3
156 0.3
157 0.29
158 0.31
159 0.29
160 0.29
161 0.21
162 0.21
163 0.17
164 0.18
165 0.18
166 0.16
167 0.16
168 0.15
169 0.15
170 0.14
171 0.13
172 0.1
173 0.11
174 0.12
175 0.15
176 0.16
177 0.15
178 0.17
179 0.2
180 0.21
181 0.22
182 0.3
183 0.3
184 0.33
185 0.38
186 0.44
187 0.48
188 0.55
189 0.62
190 0.64
191 0.7
192 0.71
193 0.66
194 0.65
195 0.59
196 0.59
197 0.6
198 0.59
199 0.56
200 0.59
201 0.68
202 0.67
203 0.7
204 0.65
205 0.62
206 0.61
207 0.61
208 0.54
209 0.48
210 0.44
211 0.4
212 0.37
213 0.31
214 0.23
215 0.2
216 0.18
217 0.14
218 0.12
219 0.12
220 0.15
221 0.18
222 0.2
223 0.22
224 0.28
225 0.3
226 0.37
227 0.42
228 0.42
229 0.45
230 0.51
231 0.52
232 0.55
233 0.55
234 0.51
235 0.5
236 0.45
237 0.39
238 0.31
239 0.26
240 0.17
241 0.17
242 0.15
243 0.12
244 0.14
245 0.17
246 0.2
247 0.24