Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9XJR5

Protein Details
Accession S9XJR5    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-38MPYRNDRKKSAKRNPDSIIHGRVPSKKTIKKHLRNGKYHydrophilic
NLS Segment(s)
PositionSequence
7-37RKKSAKRNPDSIIHGRVPSKKTIKKHLRNGK
Subcellular Location(s) nucl 18, mito_nucl 12.833, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
Amino Acid Sequences MPYRNDRKKSAKRNPDSIIHGRVPSKKTIKKHLRNGKYSLKRLAEQGIHLDDAMMEIEAVSGNKEKKNKNKLFGNSEEQQQDNFMSVDQPTGNGTILGAPPSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.79
3 0.76
4 0.71
5 0.66
6 0.58
7 0.53
8 0.49
9 0.5
10 0.45
11 0.46
12 0.49
13 0.49
14 0.52
15 0.59
16 0.66
17 0.7
18 0.78
19 0.8
20 0.8
21 0.79
22 0.8
23 0.79
24 0.77
25 0.72
26 0.68
27 0.61
28 0.52
29 0.49
30 0.46
31 0.36
32 0.28
33 0.26
34 0.2
35 0.17
36 0.16
37 0.14
38 0.09
39 0.08
40 0.07
41 0.04
42 0.03
43 0.02
44 0.03
45 0.03
46 0.03
47 0.04
48 0.07
49 0.09
50 0.12
51 0.18
52 0.25
53 0.35
54 0.46
55 0.52
56 0.57
57 0.64
58 0.68
59 0.7
60 0.69
61 0.66
62 0.58
63 0.56
64 0.51
65 0.43
66 0.36
67 0.3
68 0.24
69 0.19
70 0.17
71 0.12
72 0.1
73 0.1
74 0.12
75 0.1
76 0.11
77 0.1
78 0.11
79 0.11
80 0.1
81 0.1
82 0.11
83 0.12