Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1J5Z7

Protein Details
Accession N1J5Z7    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
25-50AGKKTASSGDKKKRTKTRKETYSSYIHydrophilic
NLS Segment(s)
PositionSequence
5-43SAEKKPSASKAPAKAPASKEAGKKTASSGDKKKRTKTRK
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MPPKSAEKKPSASKAPAKAPASKEAGKKTASSGDKKKRTKTRKETYSSYIYKVLKQVHPDTGISNRAMSILNSFVNGTVATEASKLAAYNKKSTISSREIQTSVRLILPGELAKHAVSEGTKAVTKYSSSTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.7
3 0.7
4 0.65
5 0.63
6 0.59
7 0.58
8 0.56
9 0.54
10 0.52
11 0.49
12 0.5
13 0.44
14 0.41
15 0.37
16 0.4
17 0.4
18 0.42
19 0.46
20 0.53
21 0.61
22 0.67
23 0.74
24 0.76
25 0.81
26 0.84
27 0.85
28 0.85
29 0.85
30 0.85
31 0.81
32 0.76
33 0.75
34 0.65
35 0.57
36 0.53
37 0.44
38 0.39
39 0.38
40 0.38
41 0.31
42 0.34
43 0.33
44 0.3
45 0.31
46 0.29
47 0.26
48 0.24
49 0.24
50 0.19
51 0.16
52 0.13
53 0.12
54 0.12
55 0.1
56 0.08
57 0.08
58 0.08
59 0.08
60 0.08
61 0.07
62 0.07
63 0.07
64 0.06
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.06
72 0.05
73 0.1
74 0.15
75 0.18
76 0.22
77 0.24
78 0.26
79 0.27
80 0.3
81 0.31
82 0.32
83 0.34
84 0.33
85 0.35
86 0.34
87 0.33
88 0.34
89 0.29
90 0.25
91 0.21
92 0.18
93 0.14
94 0.14
95 0.15
96 0.14
97 0.13
98 0.12
99 0.13
100 0.12
101 0.12
102 0.11
103 0.11
104 0.1
105 0.11
106 0.12
107 0.13
108 0.16
109 0.16
110 0.18
111 0.18
112 0.19