Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1JGI2

Protein Details
Accession N1JGI2    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPANTGAKKQKKKWSKGKVKDKAQHVVIHydrophilic
NLS Segment(s)
PositionSequence
8-22AKKQKKKWSKGKVKD
Subcellular Location(s) nucl 13.5, mito_nucl 11, mito 7.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPANTGAKKQKKKWSKGKVKDKAQHVVILDKATSDKLYKDVQSYRLVTVATLVDRLKINGSLARRCLKDLEEKGQIKKVVGHSKLQIYSTHNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.89
4 0.9
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.81
11 0.72
12 0.65
13 0.55
14 0.48
15 0.38
16 0.32
17 0.25
18 0.18
19 0.16
20 0.13
21 0.13
22 0.1
23 0.09
24 0.11
25 0.14
26 0.15
27 0.18
28 0.2
29 0.23
30 0.26
31 0.27
32 0.24
33 0.23
34 0.22
35 0.17
36 0.16
37 0.13
38 0.08
39 0.09
40 0.08
41 0.09
42 0.09
43 0.1
44 0.1
45 0.1
46 0.1
47 0.12
48 0.16
49 0.18
50 0.22
51 0.27
52 0.27
53 0.27
54 0.28
55 0.28
56 0.34
57 0.35
58 0.38
59 0.42
60 0.45
61 0.47
62 0.51
63 0.5
64 0.41
65 0.42
66 0.44
67 0.44
68 0.43
69 0.45
70 0.44
71 0.5
72 0.51
73 0.47
74 0.42