Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1JQH5

Protein Details
Accession N1JQH5    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
107-133EERNAAKEEKRRLKQERSEKKLSNKLLHydrophilic
NLS Segment(s)
PositionSequence
113-127KEEKRRLKQERSEKK
Subcellular Location(s) mito 12, nucl 8.5, cyto_nucl 8, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR000266  Ribosomal_S17/S11  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00366  Ribosomal_S17  
Amino Acid Sequences MSKSRAIALMREIPAVVVSAGLMQKTVKVQVGVQQWNSHIKKISLVKYFNRRRNHLVHDPNDSVRIGDIVAISAGSRVAKHVRHVVTKIIAPFGVPIEERPPIPTIEERNAAKEEKRRLKQERSEKKLSNKLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.14
4 0.06
5 0.05
6 0.07
7 0.08
8 0.08
9 0.08
10 0.07
11 0.09
12 0.1
13 0.13
14 0.12
15 0.12
16 0.13
17 0.19
18 0.26
19 0.29
20 0.29
21 0.29
22 0.29
23 0.38
24 0.38
25 0.35
26 0.3
27 0.26
28 0.3
29 0.35
30 0.4
31 0.37
32 0.4
33 0.44
34 0.53
35 0.62
36 0.63
37 0.63
38 0.61
39 0.6
40 0.62
41 0.64
42 0.62
43 0.61
44 0.57
45 0.56
46 0.53
47 0.48
48 0.43
49 0.35
50 0.26
51 0.17
52 0.14
53 0.08
54 0.06
55 0.06
56 0.04
57 0.04
58 0.04
59 0.04
60 0.03
61 0.04
62 0.03
63 0.03
64 0.05
65 0.09
66 0.1
67 0.13
68 0.2
69 0.23
70 0.26
71 0.28
72 0.29
73 0.28
74 0.29
75 0.28
76 0.21
77 0.18
78 0.15
79 0.14
80 0.12
81 0.11
82 0.09
83 0.09
84 0.11
85 0.13
86 0.13
87 0.14
88 0.15
89 0.14
90 0.17
91 0.21
92 0.23
93 0.27
94 0.33
95 0.32
96 0.34
97 0.36
98 0.36
99 0.37
100 0.39
101 0.44
102 0.49
103 0.56
104 0.62
105 0.68
106 0.75
107 0.8
108 0.84
109 0.85
110 0.83
111 0.85
112 0.83
113 0.84