Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1J973

Protein Details
Accession N1J973    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
207-226DGPTRPAKVPKKFKANKELEHydrophilic
NLS Segment(s)
PositionSequence
210-247TRPAKVPKKFKANKELEAGKSKWQDFAAKGKIGKTAKK
Subcellular Location(s) cyto_nucl 12.833, cyto 12, nucl 11.5, mito_nucl 7.166, cyto_pero 7.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR002999  Tudor  
IPR043560  ZGPAT  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
GO:0045892  P:negative regulation of DNA-templated transcription  
CDD cd20446  Tudor_SpSPF30-like  
Amino Acid Sequences MNNERIAFENEIKEYRVQLETVQLGLQADPDSVELQQLKTELEQVISLTEAAIAELKPISVPTAVSKKPLEPPPKEKWSRENHPAFKKSIATLEEDAPTSFKVNDTVLAKWHSGDKGFYPARITSITGSSIAPVYIVKFKSYDNIETLRAKDIKPIVNPNKRKADGTPVTASNHFSPSVPNNVISAAAEINPQLAQQTKREPSKVSDGPTRPAKVPKKFKANKELEAGKSKWQDFAAKGKIGKTAKKESMFRTPEGVHGRVGFTGSGQTMRKDQIRTRHIYNVNGDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.25
4 0.21
5 0.19
6 0.23
7 0.22
8 0.22
9 0.2
10 0.17
11 0.16
12 0.15
13 0.15
14 0.1
15 0.09
16 0.09
17 0.09
18 0.09
19 0.09
20 0.12
21 0.12
22 0.12
23 0.14
24 0.14
25 0.14
26 0.14
27 0.17
28 0.14
29 0.13
30 0.13
31 0.12
32 0.12
33 0.11
34 0.1
35 0.07
36 0.07
37 0.06
38 0.06
39 0.07
40 0.06
41 0.07
42 0.07
43 0.07
44 0.06
45 0.07
46 0.08
47 0.07
48 0.08
49 0.12
50 0.2
51 0.21
52 0.25
53 0.26
54 0.28
55 0.36
56 0.44
57 0.47
58 0.47
59 0.54
60 0.59
61 0.68
62 0.71
63 0.67
64 0.67
65 0.68
66 0.69
67 0.71
68 0.72
69 0.7
70 0.74
71 0.74
72 0.67
73 0.6
74 0.54
75 0.45
76 0.4
77 0.32
78 0.27
79 0.25
80 0.25
81 0.23
82 0.22
83 0.21
84 0.16
85 0.15
86 0.12
87 0.1
88 0.09
89 0.09
90 0.09
91 0.13
92 0.14
93 0.14
94 0.16
95 0.18
96 0.17
97 0.16
98 0.19
99 0.16
100 0.14
101 0.15
102 0.13
103 0.19
104 0.2
105 0.2
106 0.2
107 0.19
108 0.2
109 0.2
110 0.19
111 0.12
112 0.13
113 0.13
114 0.11
115 0.11
116 0.1
117 0.09
118 0.08
119 0.07
120 0.06
121 0.06
122 0.09
123 0.1
124 0.1
125 0.11
126 0.11
127 0.15
128 0.17
129 0.18
130 0.16
131 0.17
132 0.2
133 0.2
134 0.21
135 0.21
136 0.21
137 0.19
138 0.21
139 0.23
140 0.24
141 0.25
142 0.34
143 0.39
144 0.47
145 0.52
146 0.55
147 0.59
148 0.57
149 0.56
150 0.47
151 0.48
152 0.42
153 0.42
154 0.38
155 0.32
156 0.33
157 0.32
158 0.33
159 0.24
160 0.22
161 0.18
162 0.15
163 0.15
164 0.15
165 0.2
166 0.19
167 0.18
168 0.16
169 0.16
170 0.16
171 0.14
172 0.13
173 0.07
174 0.07
175 0.07
176 0.06
177 0.07
178 0.06
179 0.06
180 0.06
181 0.09
182 0.11
183 0.14
184 0.22
185 0.28
186 0.32
187 0.35
188 0.36
189 0.36
190 0.44
191 0.45
192 0.42
193 0.44
194 0.42
195 0.46
196 0.51
197 0.5
198 0.44
199 0.49
200 0.54
201 0.55
202 0.63
203 0.65
204 0.69
205 0.74
206 0.79
207 0.81
208 0.78
209 0.74
210 0.71
211 0.69
212 0.63
213 0.63
214 0.56
215 0.53
216 0.52
217 0.48
218 0.43
219 0.38
220 0.38
221 0.34
222 0.41
223 0.4
224 0.38
225 0.39
226 0.37
227 0.43
228 0.43
229 0.46
230 0.45
231 0.48
232 0.51
233 0.56
234 0.61
235 0.58
236 0.64
237 0.63
238 0.57
239 0.53
240 0.46
241 0.47
242 0.48
243 0.43
244 0.35
245 0.32
246 0.32
247 0.26
248 0.26
249 0.19
250 0.13
251 0.14
252 0.13
253 0.17
254 0.17
255 0.19
256 0.22
257 0.27
258 0.32
259 0.36
260 0.41
261 0.46
262 0.53
263 0.57
264 0.59
265 0.64
266 0.63
267 0.63
268 0.64