Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5A0E5

Protein Details
Accession Q5A0E5    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
218-238NTQSKDPRRKHVCKVCSRSFTHydrophilic
272-299NCNQHYKTHTNGKNKRNRQQHRTLEASHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0031519  C:PcG protein complex  
GO:0005667  C:transcription regulator complex  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0003690  F:double-stranded DNA binding  
GO:0046872  F:metal ion binding  
GO:0000978  F:RNA polymerase II cis-regulatory region sequence-specific DNA binding  
GO:0097316  P:cellular response to N-acetyl-D-glucosamine  
GO:0036244  P:cellular response to neutral pH  
GO:0009267  P:cellular response to starvation  
GO:0001410  P:chlamydospore formation  
GO:0044114  P:development of symbiont in host  
GO:0030447  P:filamentous growth  
GO:0045892  P:negative regulation of DNA-templated transcription  
GO:0060258  P:negative regulation of filamentous growth  
GO:0045827  P:negative regulation of isoprenoid metabolic process  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0009372  P:quorum sensing  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG cal:CAALFM_C704230WA  -  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MLYQQSYPITNKLLNASAAGSTSTASIIDGGCTLSKPGSGKTKSTTSLPSFNELLTSIPLPNEFKPSTKNTNQAAAATATSPYNYYMGPPAQHRLPTPPPYPMSSPTTATAATPLSQQSPHLQPQQTLQQPQPYHQQYYNYQYAAPPYPHPSQVPPPASYQQRHQQPMYQNTNGVPIIIRPSPGLITPTSTTFDHAKIRSNSTGDLSANSLALSSNNNTQSKDPRRKHVCKVCSRSFTTSGHLARHNRIHTGERKHQCPWPTCEARFARQDNCNQHYKTHTNGKNKRNRQQHRTLEASHVGTKYNTKSLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.22
4 0.19
5 0.17
6 0.16
7 0.12
8 0.1
9 0.09
10 0.09
11 0.07
12 0.07
13 0.07
14 0.07
15 0.07
16 0.07
17 0.08
18 0.08
19 0.09
20 0.1
21 0.09
22 0.11
23 0.12
24 0.17
25 0.26
26 0.29
27 0.32
28 0.36
29 0.42
30 0.42
31 0.44
32 0.46
33 0.42
34 0.46
35 0.45
36 0.44
37 0.39
38 0.36
39 0.34
40 0.26
41 0.22
42 0.16
43 0.16
44 0.12
45 0.11
46 0.14
47 0.16
48 0.16
49 0.22
50 0.21
51 0.22
52 0.26
53 0.33
54 0.39
55 0.42
56 0.48
57 0.44
58 0.49
59 0.48
60 0.44
61 0.39
62 0.31
63 0.26
64 0.19
65 0.17
66 0.11
67 0.1
68 0.1
69 0.09
70 0.09
71 0.08
72 0.09
73 0.12
74 0.13
75 0.15
76 0.17
77 0.2
78 0.21
79 0.23
80 0.24
81 0.27
82 0.32
83 0.37
84 0.37
85 0.39
86 0.38
87 0.4
88 0.41
89 0.38
90 0.36
91 0.32
92 0.31
93 0.27
94 0.26
95 0.23
96 0.2
97 0.18
98 0.13
99 0.11
100 0.1
101 0.1
102 0.1
103 0.1
104 0.11
105 0.14
106 0.18
107 0.22
108 0.27
109 0.27
110 0.26
111 0.29
112 0.36
113 0.36
114 0.34
115 0.32
116 0.32
117 0.32
118 0.33
119 0.39
120 0.34
121 0.33
122 0.32
123 0.35
124 0.31
125 0.37
126 0.38
127 0.29
128 0.27
129 0.24
130 0.25
131 0.23
132 0.21
133 0.16
134 0.18
135 0.2
136 0.21
137 0.22
138 0.22
139 0.25
140 0.31
141 0.32
142 0.28
143 0.3
144 0.33
145 0.36
146 0.35
147 0.34
148 0.34
149 0.39
150 0.41
151 0.38
152 0.39
153 0.42
154 0.49
155 0.51
156 0.44
157 0.38
158 0.35
159 0.38
160 0.32
161 0.25
162 0.15
163 0.09
164 0.12
165 0.12
166 0.12
167 0.09
168 0.09
169 0.1
170 0.1
171 0.12
172 0.08
173 0.11
174 0.11
175 0.13
176 0.15
177 0.14
178 0.16
179 0.16
180 0.19
181 0.21
182 0.22
183 0.28
184 0.28
185 0.32
186 0.32
187 0.32
188 0.3
189 0.27
190 0.29
191 0.21
192 0.2
193 0.17
194 0.14
195 0.13
196 0.12
197 0.1
198 0.07
199 0.07
200 0.08
201 0.08
202 0.13
203 0.19
204 0.21
205 0.22
206 0.25
207 0.34
208 0.43
209 0.52
210 0.52
211 0.57
212 0.66
213 0.72
214 0.8
215 0.8
216 0.79
217 0.79
218 0.84
219 0.82
220 0.79
221 0.76
222 0.71
223 0.66
224 0.58
225 0.51
226 0.5
227 0.43
228 0.4
229 0.42
230 0.4
231 0.42
232 0.47
233 0.45
234 0.41
235 0.41
236 0.45
237 0.46
238 0.52
239 0.56
240 0.56
241 0.58
242 0.59
243 0.61
244 0.61
245 0.6
246 0.57
247 0.57
248 0.58
249 0.55
250 0.61
251 0.6
252 0.58
253 0.59
254 0.57
255 0.54
256 0.52
257 0.6
258 0.59
259 0.6
260 0.62
261 0.55
262 0.55
263 0.56
264 0.54
265 0.53
266 0.54
267 0.57
268 0.6
269 0.68
270 0.75
271 0.78
272 0.84
273 0.86
274 0.86
275 0.89
276 0.87
277 0.89
278 0.89
279 0.86
280 0.83
281 0.76
282 0.72
283 0.67
284 0.62
285 0.56
286 0.46
287 0.39
288 0.35
289 0.38
290 0.36