Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1J5G0

Protein Details
Accession N1J5G0    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MVSAKKHVPIVKKRTKRFHRHQSDTYKCVHydrophilic
NLS Segment(s)
PositionSequence
12-16KKRTK
Subcellular Location(s) mito 20.5, mito_nucl 13.666, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKRTKRFHRHQSDTYKCVDPSWRKPKGIDNRVRRRFAGQIAMPSIGYGSNKKTRHMMPSGHKAFLVHNIRDIDLLLMHNKTFAAEISHSVSSRKRIEIIQRAKELSVKVTNSKARITTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.88
3 0.9
4 0.9
5 0.91
6 0.91
7 0.9
8 0.9
9 0.9
10 0.87
11 0.79
12 0.73
13 0.66
14 0.55
15 0.48
16 0.48
17 0.45
18 0.48
19 0.55
20 0.57
21 0.54
22 0.56
23 0.64
24 0.66
25 0.68
26 0.67
27 0.68
28 0.72
29 0.79
30 0.79
31 0.71
32 0.63
33 0.57
34 0.5
35 0.46
36 0.36
37 0.31
38 0.3
39 0.29
40 0.25
41 0.21
42 0.18
43 0.11
44 0.11
45 0.09
46 0.11
47 0.19
48 0.2
49 0.21
50 0.25
51 0.26
52 0.31
53 0.33
54 0.35
55 0.34
56 0.44
57 0.45
58 0.42
59 0.4
60 0.35
61 0.31
62 0.34
63 0.33
64 0.23
65 0.24
66 0.25
67 0.25
68 0.25
69 0.24
70 0.15
71 0.1
72 0.11
73 0.09
74 0.09
75 0.09
76 0.09
77 0.08
78 0.08
79 0.08
80 0.07
81 0.09
82 0.09
83 0.11
84 0.15
85 0.17
86 0.17
87 0.19
88 0.21
89 0.24
90 0.27
91 0.27
92 0.25
93 0.29
94 0.38
95 0.47
96 0.53
97 0.55
98 0.56
99 0.56
100 0.54
101 0.53
102 0.45
103 0.4
104 0.37
105 0.33
106 0.32
107 0.39
108 0.43
109 0.43
110 0.45
111 0.43