Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q59V85

Protein Details
Accession Q59V85    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-53NSNPEVLLRKRKNADRKRIEKQEQIRERQLNKNKLKKKNQNKFIRAETLHydrophilic
61-84ELERKRIKSLIKKQKQTQQQQESAHydrophilic
NLS Segment(s)
PositionSequence
13-46RKRKNADRKRIEKQEQIRERQLNKNKLKKKNQNK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036919  L30_ferredoxin-like_sf  
IPR016082  Ribosomal_L30_ferredoxin-like  
IPR039699  Ribosomal_L7/L30  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0005730  C:nucleolus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0003723  F:RNA binding  
GO:0042134  F:rRNA primary transcript binding  
GO:0003735  F:structural constituent of ribosome  
GO:0000465  P:exonucleolytic trimming to generate mature 5'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG cal:CAALFM_CR06120WA  -  
Pfam View protein in Pfam  
PF00327  Ribosomal_L30  
Amino Acid Sequences MAILNSNPEVLLRKRKNADRKRIEKQEQIRERQLNKNKLKKKNQNKFIRAETLVSNHKSNELERKRIKSLIKKQKQTQQQQESAAADSGDAKLLFLIRIPNHTKGLKLPSKVYKILKDLKLTSVNTGTFVKADSQTMDSLKFIAPYVLVGQPSLTSIRKLFQKRARIMVPDEEQEQEKTTNEQEAGQSEDSESETKQKIIKLDNNQLVEDKFGNDLGLICIEDLIHEISQLSDNFNSITNWLLPFQLNAPVNGWGPQAKLARLLKADENKQKISLAQDFKLQEVEDIDKIIDEQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.61
3 0.71
4 0.77
5 0.82
6 0.82
7 0.86
8 0.88
9 0.9
10 0.89
11 0.87
12 0.86
13 0.86
14 0.85
15 0.83
16 0.82
17 0.79
18 0.77
19 0.78
20 0.79
21 0.78
22 0.79
23 0.81
24 0.82
25 0.84
26 0.89
27 0.89
28 0.91
29 0.91
30 0.91
31 0.92
32 0.9
33 0.86
34 0.81
35 0.78
36 0.68
37 0.6
38 0.52
39 0.47
40 0.46
41 0.42
42 0.37
43 0.3
44 0.32
45 0.3
46 0.31
47 0.36
48 0.36
49 0.43
50 0.48
51 0.53
52 0.54
53 0.59
54 0.64
55 0.63
56 0.68
57 0.7
58 0.72
59 0.75
60 0.79
61 0.81
62 0.83
63 0.83
64 0.83
65 0.8
66 0.76
67 0.7
68 0.66
69 0.58
70 0.49
71 0.39
72 0.28
73 0.19
74 0.14
75 0.12
76 0.1
77 0.08
78 0.07
79 0.07
80 0.07
81 0.07
82 0.07
83 0.11
84 0.1
85 0.17
86 0.21
87 0.24
88 0.28
89 0.28
90 0.28
91 0.28
92 0.36
93 0.35
94 0.33
95 0.36
96 0.39
97 0.43
98 0.48
99 0.48
100 0.43
101 0.44
102 0.5
103 0.48
104 0.45
105 0.42
106 0.4
107 0.42
108 0.38
109 0.34
110 0.29
111 0.25
112 0.23
113 0.22
114 0.18
115 0.13
116 0.13
117 0.12
118 0.1
119 0.1
120 0.09
121 0.1
122 0.11
123 0.12
124 0.12
125 0.1
126 0.1
127 0.1
128 0.09
129 0.08
130 0.07
131 0.06
132 0.06
133 0.08
134 0.08
135 0.08
136 0.07
137 0.07
138 0.07
139 0.08
140 0.1
141 0.08
142 0.08
143 0.09
144 0.12
145 0.19
146 0.22
147 0.3
148 0.34
149 0.43
150 0.45
151 0.51
152 0.5
153 0.46
154 0.45
155 0.42
156 0.38
157 0.3
158 0.29
159 0.24
160 0.22
161 0.2
162 0.19
163 0.14
164 0.13
165 0.13
166 0.12
167 0.13
168 0.13
169 0.13
170 0.13
171 0.13
172 0.16
173 0.14
174 0.14
175 0.12
176 0.12
177 0.12
178 0.12
179 0.11
180 0.12
181 0.13
182 0.15
183 0.17
184 0.19
185 0.21
186 0.27
187 0.34
188 0.37
189 0.45
190 0.49
191 0.49
192 0.47
193 0.45
194 0.38
195 0.33
196 0.26
197 0.18
198 0.12
199 0.11
200 0.1
201 0.09
202 0.09
203 0.08
204 0.08
205 0.07
206 0.06
207 0.06
208 0.06
209 0.05
210 0.06
211 0.07
212 0.06
213 0.06
214 0.07
215 0.07
216 0.11
217 0.11
218 0.12
219 0.11
220 0.11
221 0.12
222 0.13
223 0.13
224 0.1
225 0.12
226 0.11
227 0.12
228 0.12
229 0.13
230 0.12
231 0.13
232 0.14
233 0.19
234 0.18
235 0.18
236 0.19
237 0.2
238 0.2
239 0.21
240 0.21
241 0.15
242 0.15
243 0.21
244 0.22
245 0.2
246 0.28
247 0.29
248 0.32
249 0.33
250 0.35
251 0.36
252 0.42
253 0.5
254 0.51
255 0.55
256 0.53
257 0.53
258 0.5
259 0.45
260 0.44
261 0.44
262 0.41
263 0.36
264 0.4
265 0.4
266 0.4
267 0.4
268 0.33
269 0.26
270 0.23
271 0.26
272 0.19
273 0.2
274 0.18
275 0.16