Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S3B7

Protein Details
Accession F4S3B7    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
103-122QVDRLTKKGKHKRVRNDSETBasic
NLS Segment(s)
PositionSequence
144-174KKASVKPRAKQSAKQSKSAKPRSSTSKRVKK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
KEGG mlr:MELLADRAFT_79141  -  
Amino Acid Sequences MITWPSFLAPYVGQMTDMASDTTNDECLSVNMSPISRQISSSRVPASSPSRLSPSVAPRRSTQTTPVRLPSWSMVVIPSDSRKSVQSHSENPMASESEQSVLQVDRLTKKGKHKRVRNDSETEYEEQPESDASASGLVQLIVQKKASVKPRAKQSAKQSKSAKPRSSTSKRVKKSMVSLKDYQPENRSQSSPCVLKRKKVEVNLTQDSEDEHAKVKSKIDREDKKLYDSIKDYFKAAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.15
5 0.12
6 0.09
7 0.1
8 0.11
9 0.12
10 0.12
11 0.11
12 0.1
13 0.1
14 0.1
15 0.13
16 0.11
17 0.12
18 0.13
19 0.13
20 0.14
21 0.16
22 0.2
23 0.17
24 0.18
25 0.19
26 0.22
27 0.24
28 0.28
29 0.28
30 0.24
31 0.24
32 0.28
33 0.32
34 0.34
35 0.34
36 0.31
37 0.34
38 0.34
39 0.36
40 0.35
41 0.4
42 0.44
43 0.46
44 0.46
45 0.43
46 0.5
47 0.52
48 0.49
49 0.47
50 0.46
51 0.49
52 0.5
53 0.52
54 0.46
55 0.42
56 0.42
57 0.34
58 0.28
59 0.21
60 0.18
61 0.14
62 0.13
63 0.14
64 0.13
65 0.14
66 0.13
67 0.13
68 0.14
69 0.16
70 0.18
71 0.2
72 0.28
73 0.3
74 0.34
75 0.38
76 0.41
77 0.38
78 0.36
79 0.34
80 0.27
81 0.22
82 0.17
83 0.13
84 0.1
85 0.1
86 0.09
87 0.09
88 0.07
89 0.07
90 0.08
91 0.09
92 0.11
93 0.14
94 0.17
95 0.21
96 0.31
97 0.41
98 0.49
99 0.57
100 0.64
101 0.72
102 0.8
103 0.84
104 0.79
105 0.75
106 0.68
107 0.62
108 0.56
109 0.48
110 0.37
111 0.29
112 0.24
113 0.18
114 0.15
115 0.11
116 0.08
117 0.06
118 0.05
119 0.04
120 0.05
121 0.05
122 0.05
123 0.05
124 0.04
125 0.04
126 0.07
127 0.09
128 0.1
129 0.1
130 0.1
131 0.12
132 0.18
133 0.25
134 0.32
135 0.37
136 0.42
137 0.52
138 0.61
139 0.63
140 0.65
141 0.68
142 0.7
143 0.67
144 0.7
145 0.66
146 0.63
147 0.7
148 0.73
149 0.69
150 0.62
151 0.65
152 0.67
153 0.69
154 0.71
155 0.72
156 0.72
157 0.7
158 0.73
159 0.71
160 0.65
161 0.67
162 0.67
163 0.64
164 0.6
165 0.6
166 0.59
167 0.62
168 0.59
169 0.54
170 0.48
171 0.46
172 0.45
173 0.44
174 0.4
175 0.35
176 0.38
177 0.4
178 0.42
179 0.42
180 0.48
181 0.47
182 0.53
183 0.59
184 0.64
185 0.65
186 0.67
187 0.71
188 0.68
189 0.74
190 0.73
191 0.67
192 0.57
193 0.5
194 0.43
195 0.36
196 0.29
197 0.21
198 0.17
199 0.17
200 0.2
201 0.22
202 0.27
203 0.32
204 0.36
205 0.45
206 0.53
207 0.6
208 0.64
209 0.73
210 0.69
211 0.68
212 0.67
213 0.59
214 0.56
215 0.51
216 0.48
217 0.45
218 0.44