Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1JCY1

Protein Details
Accession N1JCY1    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
21-43SSARIKRNKKSAQTKFKVRCQRHHydrophilic
NLS Segment(s)
PositionSequence
24-30RIKRNKK
77-79KGK
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPRETSDIKQFIEICRRKDASSARIKRNKKSAQTKFKVRCQRHLYTLVLKDSEKVEKLKQSLPPNLIIADTPKKNAKGKRTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.45
3 0.46
4 0.42
5 0.47
6 0.48
7 0.47
8 0.53
9 0.58
10 0.6
11 0.67
12 0.71
13 0.71
14 0.75
15 0.74
16 0.73
17 0.75
18 0.75
19 0.77
20 0.8
21 0.83
22 0.8
23 0.81
24 0.81
25 0.73
26 0.72
27 0.68
28 0.64
29 0.59
30 0.56
31 0.5
32 0.46
33 0.47
34 0.38
35 0.33
36 0.29
37 0.25
38 0.23
39 0.23
40 0.19
41 0.19
42 0.2
43 0.24
44 0.27
45 0.31
46 0.36
47 0.4
48 0.45
49 0.45
50 0.44
51 0.4
52 0.37
53 0.33
54 0.26
55 0.25
56 0.26
57 0.26
58 0.27
59 0.32
60 0.37
61 0.44
62 0.51