Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1JKP6

Protein Details
Accession N1JKP6   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
28-47TSGTKISHARKPNQHRSYKVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, cyto_mito 10.5, cyto 5.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010300  CDO_1  
IPR014710  RmlC-like_jellyroll  
IPR011051  RmlC_Cupin_sf  
Gene Ontology GO:0017172  F:cysteine dioxygenase activity  
GO:0005506  F:iron ion binding  
Pfam View protein in Pfam  
PF05995  CDO_I  
CDD cd10548  cupin_CDO  
Amino Acid Sequences MNVYPNLTTAVKSRGSLGLTLNFCRCITSGTKISHARKPNQHRSYKVSSPAEFILHEPKELLASGITTFLPPRSGFRGLVESLSTTLKTTNPPSISRLRALLRAYNSDSLEWSKFAQADATKQYTRNLVYEVPNLFNLLLLVWTPCKASPIHDHTDSHCLMKILKGNLRERRYGIPHASYNCPLVQTSDLNYGLNKVAYMSDKLGVHEISNQSQSEYAVSLHLYFPPNAALRGCKVYNVKTGEYNHTMPTTYDSIVEPNSIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.26
4 0.26
5 0.28
6 0.29
7 0.32
8 0.31
9 0.3
10 0.28
11 0.28
12 0.25
13 0.21
14 0.22
15 0.25
16 0.31
17 0.31
18 0.39
19 0.46
20 0.5
21 0.55
22 0.59
23 0.61
24 0.65
25 0.73
26 0.77
27 0.78
28 0.81
29 0.79
30 0.78
31 0.77
32 0.73
33 0.72
34 0.67
35 0.58
36 0.53
37 0.49
38 0.43
39 0.35
40 0.31
41 0.3
42 0.24
43 0.23
44 0.2
45 0.18
46 0.18
47 0.17
48 0.15
49 0.07
50 0.07
51 0.07
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.11
58 0.1
59 0.13
60 0.17
61 0.2
62 0.2
63 0.22
64 0.25
65 0.23
66 0.24
67 0.21
68 0.16
69 0.15
70 0.15
71 0.13
72 0.09
73 0.1
74 0.1
75 0.13
76 0.15
77 0.2
78 0.22
79 0.23
80 0.27
81 0.32
82 0.34
83 0.32
84 0.33
85 0.28
86 0.3
87 0.3
88 0.3
89 0.26
90 0.27
91 0.28
92 0.27
93 0.26
94 0.22
95 0.21
96 0.2
97 0.18
98 0.16
99 0.14
100 0.12
101 0.11
102 0.11
103 0.13
104 0.11
105 0.13
106 0.16
107 0.2
108 0.19
109 0.2
110 0.21
111 0.21
112 0.22
113 0.2
114 0.18
115 0.16
116 0.17
117 0.2
118 0.2
119 0.18
120 0.17
121 0.16
122 0.14
123 0.12
124 0.09
125 0.06
126 0.05
127 0.04
128 0.04
129 0.04
130 0.05
131 0.05
132 0.05
133 0.07
134 0.07
135 0.1
136 0.17
137 0.23
138 0.28
139 0.29
140 0.31
141 0.31
142 0.37
143 0.34
144 0.27
145 0.23
146 0.18
147 0.16
148 0.18
149 0.2
150 0.19
151 0.22
152 0.27
153 0.34
154 0.42
155 0.45
156 0.45
157 0.43
158 0.45
159 0.46
160 0.46
161 0.42
162 0.38
163 0.39
164 0.4
165 0.41
166 0.36
167 0.33
168 0.28
169 0.25
170 0.21
171 0.18
172 0.17
173 0.15
174 0.16
175 0.19
176 0.19
177 0.18
178 0.18
179 0.18
180 0.17
181 0.15
182 0.13
183 0.08
184 0.09
185 0.11
186 0.13
187 0.13
188 0.16
189 0.16
190 0.17
191 0.19
192 0.18
193 0.16
194 0.2
195 0.21
196 0.2
197 0.23
198 0.22
199 0.2
200 0.2
201 0.2
202 0.16
203 0.14
204 0.11
205 0.09
206 0.1
207 0.11
208 0.11
209 0.14
210 0.15
211 0.14
212 0.15
213 0.18
214 0.19
215 0.19
216 0.2
217 0.19
218 0.2
219 0.26
220 0.26
221 0.27
222 0.31
223 0.34
224 0.4
225 0.42
226 0.41
227 0.41
228 0.45
229 0.47
230 0.48
231 0.46
232 0.41
233 0.38
234 0.36
235 0.3
236 0.31
237 0.27
238 0.22
239 0.21
240 0.19
241 0.21
242 0.21