Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1J551

Protein Details
Accession N1J551    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
104-128GADWGTKARKRQKRAIKRIMEEKEEBasic
NLS Segment(s)
PositionSequence
110-121KARKRQKRAIKR
Subcellular Location(s) cyto 10cyto_nucl 10, nucl 8, pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MSTISEIVKQGGENLVHNVWGMCERICLRDFIRIIIIVGGYLLLRPYLLKFAAKIQAKQYANDADTDVSTSSDKLSHNQLRGTGAVDLPHSDSEDNQNDRIASGADWGTKARKRQKRAIKRIMEEKEEKWLEAEGDIDDKEIMDLLVHYEEEKDGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.18
4 0.18
5 0.16
6 0.13
7 0.13
8 0.13
9 0.09
10 0.13
11 0.14
12 0.18
13 0.19
14 0.21
15 0.2
16 0.26
17 0.27
18 0.24
19 0.25
20 0.21
21 0.21
22 0.19
23 0.17
24 0.09
25 0.09
26 0.07
27 0.05
28 0.05
29 0.04
30 0.03
31 0.03
32 0.04
33 0.05
34 0.07
35 0.09
36 0.09
37 0.1
38 0.14
39 0.22
40 0.24
41 0.25
42 0.25
43 0.33
44 0.33
45 0.33
46 0.33
47 0.29
48 0.27
49 0.25
50 0.23
51 0.14
52 0.14
53 0.14
54 0.11
55 0.08
56 0.08
57 0.07
58 0.07
59 0.09
60 0.09
61 0.1
62 0.18
63 0.21
64 0.22
65 0.23
66 0.23
67 0.22
68 0.22
69 0.22
70 0.15
71 0.11
72 0.1
73 0.09
74 0.09
75 0.09
76 0.09
77 0.08
78 0.07
79 0.08
80 0.13
81 0.19
82 0.2
83 0.19
84 0.2
85 0.19
86 0.19
87 0.19
88 0.14
89 0.08
90 0.08
91 0.09
92 0.08
93 0.09
94 0.1
95 0.16
96 0.18
97 0.27
98 0.35
99 0.42
100 0.49
101 0.58
102 0.69
103 0.75
104 0.82
105 0.85
106 0.84
107 0.82
108 0.85
109 0.81
110 0.77
111 0.7
112 0.6
113 0.6
114 0.51
115 0.45
116 0.36
117 0.31
118 0.24
119 0.2
120 0.2
121 0.1
122 0.12
123 0.11
124 0.11
125 0.1
126 0.09
127 0.09
128 0.08
129 0.07
130 0.05
131 0.05
132 0.07
133 0.08
134 0.08
135 0.09
136 0.1