Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4R6P2

Protein Details
Accession F4R6P2    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
180-207IASSSSTKIKPRKTKKKSMNHTSMIPRFHydrophilic
NLS Segment(s)
PositionSequence
188-196IKPRKTKKK
Subcellular Location(s) nucl 14.5, mito_nucl 11.5, mito 7.5, cyto 5
Family & Domain DBs
KEGG mlr:MELLADRAFT_101698  -  
Amino Acid Sequences MPVASRRQLPPGIRRSPQGIRQTSTVIRQPSTGMRVVESVPVDGLFNMVEQVNKVFFLSKCVDYPNFPTTPNGDKIQYLEPMQTTTGRIVNSFGQIVPAFRRPILISGPTGCLPGSFDARMCNFRGDIVSVDPTKKDIQVTCNGPPHFQLTSSIPPKKVIKSKPPVDLSDRSYGNDANAIASSSSTKIKPRKTKKKSMNHTSMIPRFEIDNESIGKGKAPVRGQGKCTCKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.61
4 0.62
5 0.63
6 0.59
7 0.54
8 0.53
9 0.55
10 0.51
11 0.5
12 0.47
13 0.41
14 0.36
15 0.33
16 0.33
17 0.33
18 0.34
19 0.32
20 0.26
21 0.24
22 0.24
23 0.24
24 0.25
25 0.21
26 0.17
27 0.14
28 0.13
29 0.13
30 0.11
31 0.1
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.07
38 0.08
39 0.08
40 0.08
41 0.09
42 0.12
43 0.11
44 0.16
45 0.2
46 0.2
47 0.2
48 0.24
49 0.25
50 0.23
51 0.29
52 0.29
53 0.26
54 0.25
55 0.26
56 0.25
57 0.29
58 0.31
59 0.28
60 0.23
61 0.23
62 0.25
63 0.26
64 0.24
65 0.2
66 0.18
67 0.16
68 0.16
69 0.16
70 0.14
71 0.13
72 0.12
73 0.14
74 0.13
75 0.12
76 0.13
77 0.13
78 0.14
79 0.13
80 0.11
81 0.11
82 0.11
83 0.11
84 0.12
85 0.14
86 0.14
87 0.13
88 0.15
89 0.13
90 0.15
91 0.16
92 0.15
93 0.13
94 0.13
95 0.15
96 0.14
97 0.14
98 0.12
99 0.1
100 0.09
101 0.09
102 0.1
103 0.08
104 0.08
105 0.1
106 0.12
107 0.14
108 0.14
109 0.13
110 0.12
111 0.12
112 0.12
113 0.11
114 0.1
115 0.1
116 0.12
117 0.12
118 0.12
119 0.12
120 0.14
121 0.14
122 0.14
123 0.15
124 0.14
125 0.17
126 0.23
127 0.27
128 0.3
129 0.36
130 0.35
131 0.33
132 0.32
133 0.32
134 0.26
135 0.22
136 0.2
137 0.17
138 0.25
139 0.31
140 0.34
141 0.31
142 0.35
143 0.38
144 0.43
145 0.47
146 0.46
147 0.5
148 0.56
149 0.62
150 0.66
151 0.67
152 0.64
153 0.62
154 0.59
155 0.53
156 0.5
157 0.45
158 0.37
159 0.35
160 0.31
161 0.25
162 0.23
163 0.18
164 0.12
165 0.11
166 0.11
167 0.09
168 0.09
169 0.1
170 0.09
171 0.13
172 0.14
173 0.21
174 0.28
175 0.38
176 0.49
177 0.59
178 0.69
179 0.75
180 0.84
181 0.87
182 0.91
183 0.92
184 0.92
185 0.9
186 0.84
187 0.82
188 0.81
189 0.76
190 0.67
191 0.57
192 0.47
193 0.38
194 0.35
195 0.31
196 0.23
197 0.21
198 0.2
199 0.22
200 0.22
201 0.21
202 0.2
203 0.21
204 0.23
205 0.26
206 0.26
207 0.33
208 0.4
209 0.45
210 0.5
211 0.55