Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1J5S1

Protein Details
Accession N1J5S1    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
56-83LVKRIEKSTTKPLKRRRPNKKLITTMNTHydrophilic
NLS Segment(s)
PositionSequence
7-19KARRSLRAKATKL
45-76KREKRANKHSSLVKRIEKSTTKPLKRRRPNKK
111-124KSRPGVMKRKDKLE
Subcellular Location(s) nucl 22, mito_nucl 14.166, cyto_nucl 12.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR028160  Slx9-like  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005730  C:nucleolus  
GO:0030688  C:preribosome, small subunit precursor  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
Pfam View protein in Pfam  
PF15341  SLX9  
Amino Acid Sequences MAPTAPKARRSLRAKATKLKAGLKSNANVDDTGILQATAKDVLSKREKRANKHSSLVKRIEKSTTKPLKRRRPNKKLITTMNTLMDALPDIEALVQGPNNVNTSIKQKSLKSRPGVMKRKDKLEKVEKARFGQNMAHIMGIEQTEMNSNVPTASSKMEAESLPDVESDTPKSTTTAKRFAALRAWAISNMEKHPSFEKTPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.77
3 0.77
4 0.74
5 0.74
6 0.72
7 0.69
8 0.66
9 0.65
10 0.6
11 0.57
12 0.55
13 0.52
14 0.46
15 0.38
16 0.32
17 0.26
18 0.21
19 0.18
20 0.13
21 0.09
22 0.08
23 0.08
24 0.09
25 0.08
26 0.07
27 0.11
28 0.12
29 0.19
30 0.29
31 0.35
32 0.39
33 0.48
34 0.54
35 0.58
36 0.68
37 0.7
38 0.66
39 0.67
40 0.7
41 0.69
42 0.71
43 0.71
44 0.67
45 0.62
46 0.58
47 0.58
48 0.54
49 0.5
50 0.54
51 0.56
52 0.57
53 0.62
54 0.7
55 0.74
56 0.81
57 0.86
58 0.87
59 0.87
60 0.89
61 0.91
62 0.9
63 0.87
64 0.84
65 0.79
66 0.71
67 0.63
68 0.53
69 0.43
70 0.34
71 0.25
72 0.17
73 0.12
74 0.08
75 0.06
76 0.04
77 0.04
78 0.03
79 0.03
80 0.04
81 0.04
82 0.03
83 0.04
84 0.05
85 0.05
86 0.06
87 0.07
88 0.07
89 0.08
90 0.13
91 0.14
92 0.17
93 0.19
94 0.21
95 0.3
96 0.38
97 0.45
98 0.43
99 0.49
100 0.55
101 0.62
102 0.69
103 0.68
104 0.7
105 0.66
106 0.72
107 0.71
108 0.66
109 0.65
110 0.64
111 0.65
112 0.64
113 0.68
114 0.62
115 0.59
116 0.6
117 0.51
118 0.44
119 0.38
120 0.33
121 0.29
122 0.25
123 0.22
124 0.17
125 0.16
126 0.15
127 0.12
128 0.09
129 0.06
130 0.06
131 0.07
132 0.08
133 0.09
134 0.08
135 0.08
136 0.07
137 0.08
138 0.09
139 0.09
140 0.1
141 0.11
142 0.11
143 0.12
144 0.14
145 0.13
146 0.15
147 0.16
148 0.15
149 0.14
150 0.13
151 0.14
152 0.13
153 0.15
154 0.15
155 0.16
156 0.16
157 0.16
158 0.18
159 0.23
160 0.31
161 0.36
162 0.41
163 0.4
164 0.44
165 0.45
166 0.46
167 0.47
168 0.42
169 0.38
170 0.33
171 0.33
172 0.29
173 0.31
174 0.31
175 0.28
176 0.28
177 0.31
178 0.28
179 0.29
180 0.33
181 0.36