Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1JDU4

Protein Details
Accession N1JDU4   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
105-131FLSRVKTQKGRKTLARRRAKKRTTLSHHydrophilic
NLS Segment(s)
PositionSequence
99-126RKRRHGFLSRVKTQKGRKTLARRRAKKR
Subcellular Location(s) mito 20, nucl 5.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MRIGTHAWQNGSLARLTIKASVASNSVISLRSFVSVYGPTRPTLTLDKTILSEQKSPAILSDRGELLDLQPKISTHPALGATQVRSGPRNTFSPSHFVRKRRHGFLSRVKTQKGRKTLARRRAKKRTTLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.15
4 0.16
5 0.15
6 0.15
7 0.15
8 0.16
9 0.16
10 0.16
11 0.15
12 0.13
13 0.13
14 0.12
15 0.11
16 0.11
17 0.1
18 0.1
19 0.1
20 0.09
21 0.11
22 0.13
23 0.15
24 0.19
25 0.19
26 0.19
27 0.2
28 0.2
29 0.2
30 0.22
31 0.24
32 0.23
33 0.22
34 0.23
35 0.23
36 0.24
37 0.24
38 0.22
39 0.22
40 0.18
41 0.2
42 0.2
43 0.18
44 0.17
45 0.19
46 0.17
47 0.15
48 0.16
49 0.13
50 0.13
51 0.13
52 0.12
53 0.09
54 0.13
55 0.12
56 0.11
57 0.12
58 0.11
59 0.13
60 0.15
61 0.15
62 0.09
63 0.11
64 0.12
65 0.12
66 0.14
67 0.15
68 0.14
69 0.15
70 0.17
71 0.16
72 0.16
73 0.18
74 0.19
75 0.19
76 0.21
77 0.24
78 0.25
79 0.26
80 0.31
81 0.34
82 0.41
83 0.44
84 0.48
85 0.53
86 0.6
87 0.67
88 0.66
89 0.71
90 0.68
91 0.71
92 0.75
93 0.76
94 0.75
95 0.73
96 0.71
97 0.7
98 0.72
99 0.72
100 0.7
101 0.67
102 0.68
103 0.73
104 0.79
105 0.81
106 0.84
107 0.85
108 0.87
109 0.91
110 0.89
111 0.88