Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1JGI3

Protein Details
Accession N1JGI3   
Localization Confidence High
Confidence Score 20.9
NoLS Segment(s)
PositionSequenceProtein Nature
517-539AAGLLKKNKERRKLLPRPLNWDSHydrophilic
602-626TKPRAAEKAKPPARARKRAVDPFEDHydrophilic
NLS Segment(s)
PositionSequence
520-530LLKKNKERRKL
587-619KKKTVAAKAPVKRNTTKPRAAEKAKPPARARKR
Subcellular Location(s) nucl 24, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004843  Calcineurin-like_PHP_ApaH  
IPR029052  Metallo-depent_PP-like  
IPR003701  Mre11  
IPR038487  Mre11_capping_dom  
IPR007281  Mre11_DNA-bd  
IPR041796  Mre11_N  
Gene Ontology GO:0140445  C:chromosome, telomeric repeat region  
GO:0030870  C:Mre11 complex  
GO:0035861  C:site of double-strand break  
GO:0008296  F:3'-5'-DNA exonuclease activity  
GO:0004017  F:adenylate kinase activity  
GO:0004520  F:DNA endonuclease activity  
GO:0003691  F:double-stranded telomeric DNA binding  
GO:0051880  F:G-quadruplex DNA binding  
GO:0030145  F:manganese ion binding  
GO:0060090  F:molecular adaptor activity  
GO:0043047  F:single-stranded telomeric DNA binding  
GO:0030437  P:ascospore formation  
GO:0006284  P:base-excision repair  
GO:0010791  P:DNA double-strand break processing involved in repair via synthesis-dependent strand annealing  
GO:1990918  P:double-strand break repair involved in meiotic recombination  
GO:0000727  P:double-strand break repair via break-induced replication  
GO:0006303  P:double-strand break repair via nonhomologous end joining  
GO:0035753  P:maintenance of DNA trinucleotide repeats  
GO:0010780  P:meiotic DNA double-strand break formation involved in reciprocal meiotic recombination  
GO:0097552  P:mitochondrial double-strand break repair via homologous recombination  
GO:0031573  P:mitotic intra-S DNA damage checkpoint signaling  
GO:0051037  P:regulation of transcription involved in meiotic cell cycle  
GO:0000723  P:telomere maintenance  
Pfam View protein in Pfam  
PF00149  Metallophos  
PF04152  Mre11_DNA_bind  
CDD cd00840  MPP_Mre11_N  
Amino Acid Sequences MTSNDADTIRILVATDSHVGYRERDPIQKDDSWKSFDEVMQLAKSQDSQVDMVLLAGDLFHENKPSRKSMYQVMRSLRKNCLGDKPCELEFLSDASDVFDGAFNHANYEDPDINIAIPVFSIHGNHDDPTGDGNFCSLDLLQVSGLCNYFGRIPESDNIQVKPVLLQKGLTKLALYGMSNVRDERLFRTFRDGNVKFFRPGVQQQDWFNLMAVHQNHHAHSDTNYLPESFLPKFLDLVIWGHEHECQIDPRLNLETKFHVMQPGSSIATSLVPSEAVAKHVAVLSITGKEFKVEKHRIRSVRPFLTKDIVLQNDTRFKRLMKLKDNRTLLTNELEKIVLQLIDEAKDEWLSIQEEEIDEKDIPLPLIRLRVEHSAPEGYNFDCENPQRFSNRFINKVANVNDVIYFHRKKKISRANVIDKNMPDASVLDIMEGDGIKVSKLVHEFLTAQSLKIIPQAEFGDSVTQFVEKGDNHAMEEFVSESLTLQVREMLALDEEEISNIDEQMEIIRTKREKLFAAGLLKKNKERRKLLPRPLNWDSDEQGEWADQPGAVIIDEDEDTTSAVVSKRAKNSLFVSDDELPIVSEPKKKTVAAKAPVKRNTTKPRAAEKAKPPARARKRAVDPFEDNNDGGLSNQTLSTRTTRRGKQTLLNLTQSQAPKKVSMELSDDEISDDAYEPDSRTTNKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.13
4 0.13
5 0.16
6 0.17
7 0.2
8 0.23
9 0.28
10 0.3
11 0.36
12 0.4
13 0.43
14 0.48
15 0.5
16 0.52
17 0.54
18 0.54
19 0.52
20 0.5
21 0.47
22 0.44
23 0.4
24 0.37
25 0.3
26 0.29
27 0.26
28 0.26
29 0.23
30 0.21
31 0.21
32 0.18
33 0.18
34 0.17
35 0.16
36 0.15
37 0.15
38 0.14
39 0.12
40 0.11
41 0.09
42 0.06
43 0.05
44 0.05
45 0.06
46 0.08
47 0.09
48 0.15
49 0.17
50 0.24
51 0.29
52 0.33
53 0.38
54 0.39
55 0.43
56 0.47
57 0.55
58 0.57
59 0.6
60 0.64
61 0.67
62 0.7
63 0.71
64 0.68
65 0.65
66 0.6
67 0.58
68 0.6
69 0.56
70 0.55
71 0.57
72 0.54
73 0.47
74 0.46
75 0.41
76 0.32
77 0.28
78 0.24
79 0.19
80 0.15
81 0.14
82 0.13
83 0.12
84 0.1
85 0.1
86 0.1
87 0.09
88 0.11
89 0.16
90 0.14
91 0.16
92 0.16
93 0.17
94 0.16
95 0.21
96 0.2
97 0.15
98 0.17
99 0.16
100 0.16
101 0.15
102 0.14
103 0.08
104 0.07
105 0.07
106 0.06
107 0.06
108 0.07
109 0.08
110 0.13
111 0.14
112 0.15
113 0.15
114 0.15
115 0.15
116 0.17
117 0.17
118 0.13
119 0.12
120 0.12
121 0.11
122 0.1
123 0.11
124 0.08
125 0.07
126 0.07
127 0.08
128 0.07
129 0.08
130 0.09
131 0.09
132 0.1
133 0.09
134 0.09
135 0.09
136 0.11
137 0.12
138 0.14
139 0.14
140 0.16
141 0.18
142 0.23
143 0.28
144 0.29
145 0.29
146 0.27
147 0.27
148 0.24
149 0.26
150 0.26
151 0.23
152 0.2
153 0.21
154 0.22
155 0.27
156 0.28
157 0.25
158 0.2
159 0.17
160 0.19
161 0.19
162 0.17
163 0.15
164 0.17
165 0.19
166 0.2
167 0.19
168 0.19
169 0.18
170 0.19
171 0.19
172 0.23
173 0.23
174 0.23
175 0.31
176 0.32
177 0.35
178 0.44
179 0.41
180 0.41
181 0.46
182 0.48
183 0.41
184 0.39
185 0.39
186 0.33
187 0.38
188 0.38
189 0.36
190 0.37
191 0.38
192 0.41
193 0.39
194 0.34
195 0.28
196 0.21
197 0.16
198 0.18
199 0.17
200 0.15
201 0.18
202 0.19
203 0.19
204 0.22
205 0.22
206 0.17
207 0.18
208 0.21
209 0.18
210 0.18
211 0.19
212 0.17
213 0.16
214 0.16
215 0.19
216 0.14
217 0.16
218 0.15
219 0.14
220 0.15
221 0.14
222 0.14
223 0.11
224 0.11
225 0.1
226 0.1
227 0.1
228 0.1
229 0.11
230 0.1
231 0.11
232 0.11
233 0.11
234 0.13
235 0.16
236 0.16
237 0.17
238 0.21
239 0.21
240 0.2
241 0.21
242 0.21
243 0.2
244 0.21
245 0.2
246 0.19
247 0.18
248 0.17
249 0.17
250 0.17
251 0.14
252 0.13
253 0.13
254 0.1
255 0.1
256 0.1
257 0.08
258 0.06
259 0.05
260 0.06
261 0.08
262 0.08
263 0.08
264 0.09
265 0.08
266 0.09
267 0.09
268 0.09
269 0.06
270 0.07
271 0.07
272 0.08
273 0.08
274 0.08
275 0.08
276 0.09
277 0.1
278 0.12
279 0.21
280 0.29
281 0.34
282 0.41
283 0.49
284 0.52
285 0.57
286 0.64
287 0.62
288 0.62
289 0.61
290 0.56
291 0.51
292 0.5
293 0.44
294 0.37
295 0.33
296 0.26
297 0.23
298 0.22
299 0.22
300 0.27
301 0.27
302 0.26
303 0.23
304 0.22
305 0.28
306 0.34
307 0.39
308 0.41
309 0.5
310 0.56
311 0.63
312 0.65
313 0.58
314 0.53
315 0.46
316 0.38
317 0.32
318 0.26
319 0.18
320 0.16
321 0.15
322 0.13
323 0.12
324 0.11
325 0.07
326 0.05
327 0.06
328 0.06
329 0.07
330 0.07
331 0.07
332 0.07
333 0.07
334 0.07
335 0.05
336 0.06
337 0.06
338 0.06
339 0.06
340 0.06
341 0.06
342 0.07
343 0.07
344 0.08
345 0.07
346 0.07
347 0.08
348 0.08
349 0.07
350 0.07
351 0.08
352 0.07
353 0.11
354 0.11
355 0.11
356 0.13
357 0.17
358 0.17
359 0.17
360 0.18
361 0.16
362 0.16
363 0.17
364 0.15
365 0.12
366 0.13
367 0.13
368 0.11
369 0.12
370 0.13
371 0.16
372 0.17
373 0.19
374 0.21
375 0.22
376 0.27
377 0.33
378 0.37
379 0.37
380 0.37
381 0.39
382 0.37
383 0.42
384 0.38
385 0.32
386 0.27
387 0.24
388 0.22
389 0.19
390 0.19
391 0.2
392 0.21
393 0.21
394 0.28
395 0.3
396 0.32
397 0.42
398 0.5
399 0.52
400 0.58
401 0.64
402 0.67
403 0.71
404 0.72
405 0.66
406 0.56
407 0.51
408 0.42
409 0.33
410 0.23
411 0.16
412 0.15
413 0.12
414 0.12
415 0.08
416 0.08
417 0.07
418 0.08
419 0.07
420 0.05
421 0.04
422 0.04
423 0.04
424 0.05
425 0.05
426 0.07
427 0.09
428 0.1
429 0.1
430 0.12
431 0.13
432 0.13
433 0.2
434 0.18
435 0.16
436 0.16
437 0.16
438 0.14
439 0.17
440 0.17
441 0.1
442 0.13
443 0.14
444 0.14
445 0.14
446 0.14
447 0.15
448 0.13
449 0.14
450 0.11
451 0.1
452 0.09
453 0.09
454 0.12
455 0.08
456 0.13
457 0.16
458 0.16
459 0.17
460 0.17
461 0.17
462 0.13
463 0.14
464 0.11
465 0.07
466 0.07
467 0.06
468 0.06
469 0.08
470 0.09
471 0.09
472 0.08
473 0.09
474 0.09
475 0.09
476 0.09
477 0.08
478 0.07
479 0.07
480 0.07
481 0.07
482 0.07
483 0.07
484 0.07
485 0.07
486 0.07
487 0.07
488 0.06
489 0.05
490 0.05
491 0.06
492 0.08
493 0.08
494 0.09
495 0.15
496 0.16
497 0.21
498 0.24
499 0.27
500 0.26
501 0.3
502 0.34
503 0.33
504 0.4
505 0.43
506 0.46
507 0.49
508 0.51
509 0.54
510 0.59
511 0.62
512 0.63
513 0.63
514 0.67
515 0.72
516 0.79
517 0.83
518 0.83
519 0.81
520 0.8
521 0.77
522 0.72
523 0.63
524 0.56
525 0.46
526 0.4
527 0.35
528 0.26
529 0.22
530 0.17
531 0.15
532 0.13
533 0.12
534 0.08
535 0.07
536 0.07
537 0.07
538 0.07
539 0.07
540 0.05
541 0.06
542 0.06
543 0.07
544 0.07
545 0.06
546 0.07
547 0.06
548 0.06
549 0.07
550 0.08
551 0.12
552 0.18
553 0.24
554 0.29
555 0.36
556 0.37
557 0.39
558 0.42
559 0.46
560 0.43
561 0.38
562 0.39
563 0.35
564 0.34
565 0.3
566 0.26
567 0.18
568 0.16
569 0.18
570 0.15
571 0.2
572 0.21
573 0.27
574 0.3
575 0.32
576 0.38
577 0.45
578 0.52
579 0.55
580 0.63
581 0.65
582 0.72
583 0.77
584 0.77
585 0.73
586 0.73
587 0.75
588 0.74
589 0.74
590 0.72
591 0.75
592 0.78
593 0.78
594 0.78
595 0.76
596 0.78
597 0.76
598 0.77
599 0.75
600 0.76
601 0.8
602 0.8
603 0.78
604 0.77
605 0.81
606 0.81
607 0.81
608 0.78
609 0.73
610 0.7
611 0.7
612 0.62
613 0.52
614 0.43
615 0.37
616 0.29
617 0.23
618 0.19
619 0.13
620 0.1
621 0.12
622 0.12
623 0.12
624 0.15
625 0.22
626 0.25
627 0.33
628 0.41
629 0.48
630 0.57
631 0.63
632 0.66
633 0.67
634 0.72
635 0.74
636 0.71
637 0.7
638 0.61
639 0.55
640 0.56
641 0.53
642 0.48
643 0.43
644 0.4
645 0.36
646 0.37
647 0.43
648 0.39
649 0.38
650 0.38
651 0.34
652 0.37
653 0.35
654 0.33
655 0.27
656 0.24
657 0.21
658 0.16
659 0.15
660 0.1
661 0.11
662 0.12
663 0.13
664 0.16
665 0.19
666 0.22