Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1JPZ4

Protein Details
Accession N1JPZ4   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
219-238TGNRGRSRWHNTGHNRSNRTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 10, mito 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045348  CPSF4/Yth1  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
Gene Ontology GO:0005829  C:cytosol  
GO:0005847  C:mRNA cleavage and polyadenylation specificity factor complex  
GO:0046872  F:metal ion binding  
GO:0003723  F:RNA binding  
GO:0006378  P:mRNA polyadenylation  
GO:0098789  P:pre-mRNA cleavage required for polyadenylation  
Pfam View protein in Pfam  
PF18345  zf_CCCH_4  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MSIILPQEPGPRELAQQILQHSAPQYNFAFSPYLNEVFGFGLSPNRPVCKAYLQGHCPSGSSCPEKHNNNSNFNNLVCKHWLRGLCKKGDSCEFLHEYNLRKMPECNFFTRHGYCSNGDPSSKLPPCPHYEKGFCALGPACSQRHLRKVLCEFYLAGFCPDGKACKNSHPRWPENLPKATVRVEKSAEELEDEQRLLIENAERELASDREKYGDRTGDTGNRGRSRWHNTGHNRSNRTGNSNRRGRYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.28
4 0.29
5 0.3
6 0.29
7 0.29
8 0.28
9 0.29
10 0.24
11 0.26
12 0.24
13 0.22
14 0.22
15 0.22
16 0.21
17 0.16
18 0.21
19 0.21
20 0.21
21 0.19
22 0.19
23 0.18
24 0.17
25 0.17
26 0.12
27 0.09
28 0.13
29 0.13
30 0.17
31 0.19
32 0.2
33 0.22
34 0.22
35 0.25
36 0.25
37 0.32
38 0.35
39 0.41
40 0.44
41 0.46
42 0.47
43 0.45
44 0.39
45 0.33
46 0.29
47 0.26
48 0.26
49 0.24
50 0.29
51 0.36
52 0.41
53 0.47
54 0.53
55 0.54
56 0.58
57 0.6
58 0.57
59 0.52
60 0.47
61 0.46
62 0.37
63 0.33
64 0.29
65 0.27
66 0.25
67 0.26
68 0.31
69 0.31
70 0.39
71 0.43
72 0.43
73 0.46
74 0.46
75 0.45
76 0.45
77 0.42
78 0.34
79 0.33
80 0.31
81 0.27
82 0.29
83 0.28
84 0.27
85 0.29
86 0.31
87 0.26
88 0.25
89 0.26
90 0.28
91 0.33
92 0.33
93 0.31
94 0.3
95 0.32
96 0.36
97 0.36
98 0.34
99 0.27
100 0.27
101 0.24
102 0.24
103 0.24
104 0.21
105 0.19
106 0.18
107 0.18
108 0.24
109 0.24
110 0.23
111 0.21
112 0.24
113 0.29
114 0.34
115 0.36
116 0.33
117 0.34
118 0.34
119 0.36
120 0.33
121 0.27
122 0.23
123 0.2
124 0.16
125 0.16
126 0.16
127 0.13
128 0.16
129 0.2
130 0.22
131 0.28
132 0.33
133 0.32
134 0.36
135 0.41
136 0.42
137 0.38
138 0.36
139 0.3
140 0.25
141 0.26
142 0.19
143 0.14
144 0.11
145 0.1
146 0.1
147 0.1
148 0.11
149 0.11
150 0.14
151 0.15
152 0.25
153 0.35
154 0.38
155 0.47
156 0.53
157 0.55
158 0.59
159 0.65
160 0.65
161 0.63
162 0.64
163 0.57
164 0.51
165 0.49
166 0.47
167 0.46
168 0.39
169 0.35
170 0.32
171 0.3
172 0.31
173 0.3
174 0.25
175 0.22
176 0.22
177 0.19
178 0.19
179 0.18
180 0.15
181 0.13
182 0.14
183 0.11
184 0.11
185 0.11
186 0.11
187 0.12
188 0.13
189 0.12
190 0.12
191 0.15
192 0.16
193 0.16
194 0.17
195 0.17
196 0.2
197 0.22
198 0.25
199 0.28
200 0.31
201 0.29
202 0.3
203 0.34
204 0.36
205 0.39
206 0.42
207 0.45
208 0.44
209 0.43
210 0.46
211 0.5
212 0.53
213 0.56
214 0.57
215 0.59
216 0.65
217 0.75
218 0.79
219 0.8
220 0.77
221 0.73
222 0.75
223 0.69
224 0.68
225 0.66
226 0.67
227 0.67
228 0.71