Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1JB13

Protein Details
Accession N1JB13    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
106-134MSGMKKRDRSKAKEKLKAKKKRTEAAAVVHydrophilic
NLS Segment(s)
PositionSequence
71-79KSKEKKDKK
109-128MKKRDRSKAKEKLKAKKKRT
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MFTGHLSHEDFFAQLSLLFESPRQKNHGSVYLTQKPMTYNTTSPAQSKDSLAQDNHPTTPLPIIVRASNGKSKEKKDKKIKLSTIVEADSLEAFFTKYAEVCKGGMSGMKKRDRSKAKEKLKAKKKRTEAAAVVAELKKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.09
5 0.1
6 0.12
7 0.19
8 0.22
9 0.26
10 0.3
11 0.3
12 0.33
13 0.38
14 0.43
15 0.4
16 0.42
17 0.47
18 0.5
19 0.5
20 0.47
21 0.43
22 0.36
23 0.35
24 0.33
25 0.28
26 0.21
27 0.22
28 0.26
29 0.26
30 0.27
31 0.27
32 0.25
33 0.23
34 0.23
35 0.25
36 0.23
37 0.26
38 0.25
39 0.25
40 0.28
41 0.28
42 0.27
43 0.23
44 0.2
45 0.17
46 0.17
47 0.15
48 0.11
49 0.1
50 0.11
51 0.1
52 0.12
53 0.14
54 0.15
55 0.18
56 0.2
57 0.25
58 0.29
59 0.34
60 0.43
61 0.5
62 0.58
63 0.65
64 0.71
65 0.74
66 0.79
67 0.78
68 0.76
69 0.71
70 0.64
71 0.55
72 0.46
73 0.37
74 0.27
75 0.24
76 0.15
77 0.11
78 0.08
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.07
86 0.09
87 0.1
88 0.1
89 0.11
90 0.11
91 0.11
92 0.14
93 0.16
94 0.21
95 0.29
96 0.36
97 0.42
98 0.46
99 0.56
100 0.62
101 0.67
102 0.71
103 0.73
104 0.76
105 0.8
106 0.85
107 0.86
108 0.86
109 0.89
110 0.87
111 0.87
112 0.85
113 0.84
114 0.82
115 0.8
116 0.74
117 0.71
118 0.65
119 0.56
120 0.52