Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1J5F3

Protein Details
Accession N1J5F3    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPPVRKKRPNAKLDNTRVRPRAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito 5
Family & Domain DBs
Amino Acid Sequences MPPVRKKRPNAKLDNTRVRPRALEQLPGLDQSSKFAEMSKVSTKGKEKALPAVTEPDTDMIGSVKIVEEFPQPSYVPHGIGELSKSPPTKSKTSENAASKSAPKLTSQPKAATKAECPPGLRPIVEAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.88
3 0.86
4 0.79
5 0.71
6 0.63
7 0.55
8 0.55
9 0.46
10 0.44
11 0.36
12 0.38
13 0.36
14 0.35
15 0.32
16 0.24
17 0.22
18 0.19
19 0.2
20 0.16
21 0.15
22 0.14
23 0.16
24 0.15
25 0.19
26 0.21
27 0.24
28 0.24
29 0.29
30 0.32
31 0.34
32 0.38
33 0.38
34 0.34
35 0.37
36 0.39
37 0.35
38 0.33
39 0.33
40 0.28
41 0.24
42 0.23
43 0.16
44 0.13
45 0.12
46 0.11
47 0.06
48 0.05
49 0.05
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.06
56 0.07
57 0.08
58 0.1
59 0.1
60 0.1
61 0.15
62 0.15
63 0.14
64 0.13
65 0.13
66 0.11
67 0.11
68 0.13
69 0.1
70 0.12
71 0.15
72 0.15
73 0.16
74 0.22
75 0.27
76 0.3
77 0.32
78 0.39
79 0.43
80 0.48
81 0.55
82 0.54
83 0.53
84 0.5
85 0.48
86 0.42
87 0.38
88 0.36
89 0.29
90 0.25
91 0.31
92 0.36
93 0.42
94 0.44
95 0.48
96 0.5
97 0.55
98 0.57
99 0.52
100 0.48
101 0.49
102 0.51
103 0.48
104 0.44
105 0.42
106 0.45
107 0.44
108 0.4