Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1J6R9

Protein Details
Accession N1J6R9    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPPVRKKRPNAKLDKTRVHPRALBasic
NLS Segment(s)
PositionSequence
6-9KKRP
Subcellular Location(s) nucl 13, mito 12
Family & Domain DBs
Amino Acid Sequences MPPVRKKRPNAKLDKTRVHPRALEQLPGLAQSLKCAEMSKVPIKGKEKALPAVTEPDTDMIGSVETIEKISQPPSVPHGIGESSKSPPTAPKMSENAAPIAASNSTSQPKSCYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.86
3 0.86
4 0.8
5 0.74
6 0.66
7 0.59
8 0.59
9 0.52
10 0.47
11 0.36
12 0.33
13 0.29
14 0.27
15 0.24
16 0.15
17 0.13
18 0.12
19 0.13
20 0.12
21 0.12
22 0.12
23 0.12
24 0.13
25 0.19
26 0.22
27 0.27
28 0.28
29 0.33
30 0.36
31 0.4
32 0.41
33 0.41
34 0.39
35 0.36
36 0.36
37 0.31
38 0.29
39 0.29
40 0.24
41 0.19
42 0.17
43 0.13
44 0.12
45 0.11
46 0.1
47 0.05
48 0.05
49 0.04
50 0.04
51 0.04
52 0.04
53 0.05
54 0.05
55 0.05
56 0.06
57 0.07
58 0.09
59 0.1
60 0.11
61 0.15
62 0.18
63 0.17
64 0.17
65 0.17
66 0.16
67 0.16
68 0.18
69 0.16
70 0.16
71 0.18
72 0.18
73 0.17
74 0.19
75 0.25
76 0.28
77 0.29
78 0.32
79 0.35
80 0.37
81 0.4
82 0.38
83 0.33
84 0.28
85 0.25
86 0.19
87 0.17
88 0.15
89 0.12
90 0.12
91 0.15
92 0.19
93 0.21
94 0.21