Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1J8Z3

Protein Details
Accession N1J8Z3    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
70-94ARSACKVIRKKKRSFWNPNNLNLKVHydrophilic
NLS Segment(s)
PositionSequence
78-81RKKK
Subcellular Location(s) mito 6, extr 6, plas 5, E.R. 5, nucl 3
Family & Domain DBs
Amino Acid Sequences MTSAYQIAMRFSSFMIASVTLCSLVSALVRSTNTPPKSHVKADNYDDPTKVLVFNCDGQIFSSRRIRSAARSACKVIRKKKRSFWNPNNLNLKVYESSVKVDTIGDKNIVSVDNTFSWPIKSGIYRLLPGRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.11
4 0.11
5 0.11
6 0.12
7 0.09
8 0.09
9 0.08
10 0.07
11 0.06
12 0.06
13 0.06
14 0.07
15 0.09
16 0.1
17 0.12
18 0.17
19 0.25
20 0.27
21 0.28
22 0.32
23 0.37
24 0.41
25 0.45
26 0.48
27 0.45
28 0.48
29 0.53
30 0.57
31 0.55
32 0.51
33 0.46
34 0.39
35 0.34
36 0.28
37 0.24
38 0.15
39 0.11
40 0.11
41 0.12
42 0.13
43 0.12
44 0.12
45 0.11
46 0.16
47 0.15
48 0.17
49 0.22
50 0.21
51 0.22
52 0.24
53 0.24
54 0.24
55 0.32
56 0.35
57 0.32
58 0.35
59 0.37
60 0.39
61 0.45
62 0.49
63 0.5
64 0.54
65 0.59
66 0.64
67 0.7
68 0.76
69 0.8
70 0.83
71 0.84
72 0.84
73 0.81
74 0.82
75 0.81
76 0.71
77 0.61
78 0.51
79 0.44
80 0.34
81 0.29
82 0.23
83 0.17
84 0.18
85 0.18
86 0.18
87 0.15
88 0.14
89 0.17
90 0.17
91 0.18
92 0.17
93 0.15
94 0.15
95 0.16
96 0.16
97 0.13
98 0.12
99 0.13
100 0.13
101 0.15
102 0.17
103 0.16
104 0.17
105 0.18
106 0.18
107 0.18
108 0.19
109 0.19
110 0.25
111 0.28
112 0.31