Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1J9U3

Protein Details
Accession N1J9U3   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MHQQLRKALNRPKKRHVHTVPPAFVHydrophilic
NLS Segment(s)
PositionSequence
74-80SLKKRKK
Subcellular Location(s) mito 22.5, cyto_mito 12.333, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039454  OM14  
IPR039453  OM14_C  
Gene Ontology GO:0005741  C:mitochondrial outer membrane  
GO:1990593  F:nascent polypeptide-associated complex binding  
Pfam View protein in Pfam  
PF17304  DUF5353  
Amino Acid Sequences MHQQLRKALNRPKKRHVHTVPPAFVAEPITTETQASRLRRERDVNYEKAQTVKSSGKSEEAHSTGQKRKTEDPSLKKRKKSEGYEAHDSSSLYSGHAALVATLGVALGYGAFRKYSAGELNGKTVGVWTGIVGTFAFADFFIYRLVSQKNSGQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.85
3 0.83
4 0.83
5 0.83
6 0.84
7 0.77
8 0.68
9 0.62
10 0.51
11 0.43
12 0.34
13 0.24
14 0.15
15 0.15
16 0.14
17 0.13
18 0.13
19 0.13
20 0.16
21 0.22
22 0.23
23 0.29
24 0.35
25 0.38
26 0.44
27 0.5
28 0.5
29 0.54
30 0.59
31 0.56
32 0.53
33 0.52
34 0.46
35 0.43
36 0.39
37 0.29
38 0.27
39 0.26
40 0.25
41 0.25
42 0.25
43 0.27
44 0.28
45 0.3
46 0.3
47 0.27
48 0.26
49 0.25
50 0.3
51 0.32
52 0.37
53 0.37
54 0.35
55 0.39
56 0.43
57 0.49
58 0.52
59 0.56
60 0.61
61 0.69
62 0.72
63 0.72
64 0.7
65 0.71
66 0.71
67 0.67
68 0.67
69 0.65
70 0.66
71 0.69
72 0.65
73 0.56
74 0.48
75 0.42
76 0.32
77 0.24
78 0.17
79 0.09
80 0.09
81 0.08
82 0.07
83 0.08
84 0.07
85 0.05
86 0.05
87 0.04
88 0.04
89 0.03
90 0.03
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.03
97 0.04
98 0.04
99 0.04
100 0.05
101 0.06
102 0.09
103 0.12
104 0.15
105 0.21
106 0.22
107 0.25
108 0.25
109 0.24
110 0.2
111 0.18
112 0.15
113 0.1
114 0.09
115 0.06
116 0.07
117 0.08
118 0.08
119 0.08
120 0.07
121 0.07
122 0.07
123 0.07
124 0.05
125 0.08
126 0.08
127 0.08
128 0.09
129 0.1
130 0.1
131 0.15
132 0.19
133 0.18
134 0.22