Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1J742

Protein Details
Accession N1J742    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
45-66GEVHGSRRKIRPQKGSGRARLGBasic
NLS Segment(s)
PositionSequence
48-67HGSRRKIRPQKGSGRARLGH
Subcellular Location(s) nucl 8.5, cyto_nucl 7, cysk 6, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002136  Ribosomal_L4/L1e  
IPR023574  Ribosomal_L4_dom_sf  
IPR013005  Ribosomal_uL4/L1e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00573  Ribosomal_L4  
Amino Acid Sequences MEPLRLETYAAKHLYLPLRRDILHRAIIFEGDHTRQGTGSTKSRGEVHGSRRKIRPQKGSGRARLGHRQSPALVGGGVSHGPHPRDFSTRLPRKMYDLAWRTALSWRYRRGELIVCENEMELEEPETLLAQHIFEHNHWGKQDGRTLMIVGGEPENLLSAMEGAGSDGRVERASEVDVKDILGLGRVVIEKKALDYLLREHQSDLVPKFRQVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.39
3 0.39
4 0.37
5 0.4
6 0.41
7 0.43
8 0.44
9 0.42
10 0.43
11 0.4
12 0.36
13 0.33
14 0.33
15 0.3
16 0.26
17 0.24
18 0.18
19 0.2
20 0.19
21 0.18
22 0.17
23 0.19
24 0.21
25 0.22
26 0.27
27 0.29
28 0.29
29 0.31
30 0.33
31 0.33
32 0.35
33 0.37
34 0.4
35 0.45
36 0.49
37 0.54
38 0.58
39 0.66
40 0.69
41 0.71
42 0.71
43 0.71
44 0.76
45 0.8
46 0.83
47 0.8
48 0.78
49 0.73
50 0.69
51 0.69
52 0.64
53 0.58
54 0.51
55 0.46
56 0.39
57 0.36
58 0.31
59 0.22
60 0.17
61 0.11
62 0.1
63 0.08
64 0.08
65 0.06
66 0.08
67 0.09
68 0.1
69 0.11
70 0.14
71 0.15
72 0.18
73 0.21
74 0.27
75 0.36
76 0.43
77 0.47
78 0.48
79 0.47
80 0.47
81 0.47
82 0.42
83 0.4
84 0.36
85 0.32
86 0.31
87 0.3
88 0.27
89 0.27
90 0.3
91 0.25
92 0.26
93 0.29
94 0.31
95 0.31
96 0.31
97 0.29
98 0.3
99 0.27
100 0.3
101 0.26
102 0.23
103 0.23
104 0.22
105 0.19
106 0.14
107 0.13
108 0.06
109 0.06
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.04
118 0.05
119 0.06
120 0.08
121 0.08
122 0.17
123 0.18
124 0.2
125 0.2
126 0.22
127 0.24
128 0.25
129 0.31
130 0.23
131 0.23
132 0.21
133 0.22
134 0.2
135 0.17
136 0.14
137 0.1
138 0.09
139 0.07
140 0.07
141 0.06
142 0.06
143 0.05
144 0.05
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.04
153 0.05
154 0.05
155 0.06
156 0.07
157 0.08
158 0.08
159 0.09
160 0.11
161 0.15
162 0.15
163 0.16
164 0.16
165 0.15
166 0.15
167 0.14
168 0.12
169 0.09
170 0.08
171 0.06
172 0.08
173 0.1
174 0.11
175 0.11
176 0.13
177 0.12
178 0.13
179 0.16
180 0.14
181 0.14
182 0.16
183 0.2
184 0.28
185 0.31
186 0.3
187 0.29
188 0.32
189 0.35
190 0.39
191 0.38
192 0.36
193 0.36