Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1D8PH38

Protein Details
Accession A0A1D8PH38    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
242-271LSSEQFPVANQQRRNRNRKKQSIDVRTFLPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001611  Leu-rich_rpt  
IPR032675  LRR_dom_sf  
KEGG cal:CAALFM_C204450WA  -  
Pfam View protein in Pfam  
PF13855  LRR_8  
Amino Acid Sequences MCHLSTNLQQLHLIANESGKIHPTTKMVAWPSSLNDFVFQNLNIDYRTLELLNLKESRLEKIDIQKGNIKTLNADLFPASVKDLSLRGMGIQQLSDSFENLENLQKLSLAGNELRELTSVKLPMATLEFLDVRHCNLRFISPFLVSMIDKKNKKAKLRVEATGNWNVSVVDIRRALKASKGLSLYLSKLDEDLVEISKRSSRLHFNGELLDTYIKKPKTDNFYNGSDSNLDEQSDVGVMKSLSSEQFPVANQQRRNRNRKKQSIDVRTFLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.16
4 0.17
5 0.17
6 0.17
7 0.18
8 0.18
9 0.2
10 0.21
11 0.23
12 0.24
13 0.3
14 0.31
15 0.3
16 0.3
17 0.29
18 0.3
19 0.3
20 0.3
21 0.23
22 0.21
23 0.2
24 0.19
25 0.2
26 0.16
27 0.14
28 0.14
29 0.15
30 0.13
31 0.14
32 0.12
33 0.11
34 0.13
35 0.11
36 0.11
37 0.13
38 0.14
39 0.19
40 0.19
41 0.18
42 0.21
43 0.22
44 0.24
45 0.24
46 0.25
47 0.24
48 0.32
49 0.4
50 0.37
51 0.4
52 0.44
53 0.42
54 0.45
55 0.44
56 0.35
57 0.28
58 0.3
59 0.29
60 0.22
61 0.22
62 0.16
63 0.14
64 0.14
65 0.13
66 0.11
67 0.08
68 0.08
69 0.08
70 0.08
71 0.09
72 0.09
73 0.09
74 0.08
75 0.09
76 0.11
77 0.1
78 0.09
79 0.08
80 0.08
81 0.1
82 0.1
83 0.09
84 0.09
85 0.09
86 0.1
87 0.11
88 0.13
89 0.11
90 0.11
91 0.11
92 0.1
93 0.1
94 0.09
95 0.09
96 0.08
97 0.08
98 0.09
99 0.09
100 0.1
101 0.09
102 0.09
103 0.1
104 0.09
105 0.1
106 0.1
107 0.09
108 0.09
109 0.09
110 0.09
111 0.1
112 0.08
113 0.06
114 0.07
115 0.07
116 0.07
117 0.09
118 0.09
119 0.09
120 0.13
121 0.13
122 0.12
123 0.13
124 0.15
125 0.14
126 0.17
127 0.17
128 0.13
129 0.14
130 0.13
131 0.14
132 0.11
133 0.14
134 0.18
135 0.23
136 0.24
137 0.28
138 0.35
139 0.39
140 0.46
141 0.5
142 0.52
143 0.56
144 0.59
145 0.59
146 0.57
147 0.55
148 0.54
149 0.52
150 0.44
151 0.33
152 0.29
153 0.25
154 0.2
155 0.18
156 0.14
157 0.11
158 0.14
159 0.15
160 0.16
161 0.17
162 0.18
163 0.18
164 0.22
165 0.2
166 0.21
167 0.22
168 0.21
169 0.22
170 0.23
171 0.21
172 0.19
173 0.18
174 0.14
175 0.13
176 0.13
177 0.1
178 0.1
179 0.1
180 0.1
181 0.1
182 0.1
183 0.11
184 0.14
185 0.15
186 0.16
187 0.19
188 0.24
189 0.28
190 0.35
191 0.37
192 0.36
193 0.37
194 0.36
195 0.32
196 0.26
197 0.24
198 0.18
199 0.18
200 0.23
201 0.22
202 0.22
203 0.25
204 0.3
205 0.37
206 0.43
207 0.47
208 0.46
209 0.49
210 0.53
211 0.5
212 0.45
213 0.37
214 0.31
215 0.27
216 0.23
217 0.19
218 0.14
219 0.14
220 0.12
221 0.12
222 0.11
223 0.07
224 0.08
225 0.08
226 0.08
227 0.09
228 0.1
229 0.1
230 0.12
231 0.13
232 0.13
233 0.15
234 0.15
235 0.24
236 0.32
237 0.39
238 0.44
239 0.52
240 0.61
241 0.7
242 0.8
243 0.82
244 0.84
245 0.87
246 0.91
247 0.91
248 0.91
249 0.92
250 0.92
251 0.89