Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8DNC3

Protein Details
Accession S8DNC3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
43-62GRFDWFRKNRKDKAWKNSIRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, pero 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001766  Fork_head_dom  
IPR030456  TF_fork_head_CS_2  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00250  Forkhead  
PROSITE View protein in PROSITE  
PS00658  FORK_HEAD_2  
PS50039  FORK_HEAD_3  
CDD cd00059  FH_FOX  
Amino Acid Sequences MLCDPASPGEKPNYPYPTLIRAAILGSPRKALTLQGIYDALEGRFDWFRKNRKDKAWKNSIRHNLSLNKLFRRLEKPANEPGKGCYWTVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.4
4 0.4
5 0.38
6 0.34
7 0.27
8 0.22
9 0.21
10 0.2
11 0.21
12 0.18
13 0.17
14 0.18
15 0.17
16 0.18
17 0.17
18 0.16
19 0.16
20 0.16
21 0.16
22 0.16
23 0.16
24 0.15
25 0.15
26 0.15
27 0.1
28 0.07
29 0.07
30 0.07
31 0.09
32 0.09
33 0.13
34 0.19
35 0.27
36 0.36
37 0.45
38 0.5
39 0.59
40 0.69
41 0.74
42 0.77
43 0.81
44 0.79
45 0.77
46 0.8
47 0.79
48 0.73
49 0.67
50 0.63
51 0.58
52 0.55
53 0.57
54 0.53
55 0.47
56 0.47
57 0.47
58 0.47
59 0.47
60 0.48
61 0.49
62 0.51
63 0.52
64 0.57
65 0.63
66 0.59
67 0.53
68 0.51
69 0.49
70 0.43