Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8FJ15

Protein Details
Accession S8FJ15    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
86-108QVELSRPKGRRLRKSFRGIVKEGHydrophilic
NLS Segment(s)
PositionSequence
91-100RPKGRRLRKS
Subcellular Location(s) mito 23.5, mito_nucl 12.833, cyto_nucl 1.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR003545  Telomerase_RT  
Gene Ontology GO:0000781  C:chromosome, telomeric region  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
GO:0003721  F:telomerase RNA reverse transcriptase activity  
Amino Acid Sequences MKMHHYLRQWGFDVKKSTAFLRSTISQMIRYTFATMRNKSSNRVAKSCGGRCEVQQDQVIWLGNHAFHTVFSRKPKIYGPLIKWLQVELSRPKGRRLRKSFRGIVKEGLSTLTLLAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.4
4 0.39
5 0.38
6 0.36
7 0.31
8 0.3
9 0.3
10 0.27
11 0.3
12 0.29
13 0.26
14 0.26
15 0.26
16 0.23
17 0.21
18 0.23
19 0.2
20 0.26
21 0.31
22 0.32
23 0.35
24 0.41
25 0.42
26 0.42
27 0.49
28 0.5
29 0.47
30 0.48
31 0.45
32 0.44
33 0.5
34 0.5
35 0.45
36 0.4
37 0.36
38 0.33
39 0.36
40 0.31
41 0.27
42 0.24
43 0.21
44 0.19
45 0.19
46 0.2
47 0.13
48 0.12
49 0.09
50 0.08
51 0.08
52 0.08
53 0.06
54 0.06
55 0.1
56 0.12
57 0.16
58 0.21
59 0.26
60 0.26
61 0.28
62 0.31
63 0.33
64 0.39
65 0.43
66 0.41
67 0.46
68 0.47
69 0.47
70 0.44
71 0.39
72 0.34
73 0.28
74 0.29
75 0.25
76 0.33
77 0.37
78 0.39
79 0.47
80 0.52
81 0.6
82 0.66
83 0.7
84 0.71
85 0.74
86 0.83
87 0.83
88 0.85
89 0.83
90 0.75
91 0.71
92 0.64
93 0.55
94 0.46
95 0.39
96 0.29
97 0.22