Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8FFJ4

Protein Details
Accession S8FFJ4    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
252-276KGELEKKKKELQKVRKEEEKLQPRDBasic
NLS Segment(s)
PositionSequence
245-268DREIKELKGELEKKKKELQKVRKE
Subcellular Location(s) mito 12, mito_nucl 10.333, cyto_mito 9.833, nucl 7.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006073  GTP-bd  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005525  F:GTP binding  
Pfam View protein in Pfam  
PF01926  MMR_HSR1  
CDD cd00882  Ras_like_GTPase  
Amino Acid Sequences MAYNNLEKLKLIAVTGPTGAGKSTFINHVCGSRLKVGTGLRSCTTQIDVAWRVMGDNKVVLIDTPGFDDTRRSQADVLKDIGDFLKKTYEEGVKLAGVIYVHRISDRRVGGIARENFRLFRSICGTDAMRNVFIVTTMWEDVAEGVGAAREHELTTKPIFFQPAVEEGAQMLRHWNNAESAESIVRSLIEHSARTLQMQRELVDEGRPMPDTSAGRDLSAFLQEQEKRHQEELQKLKEDLKSARDREIKELKGELEKKKKELQKVRKEEEKLQPRDGIRYYLKAGYRVEVRVLLCWKVYRIMEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.17
4 0.15
5 0.14
6 0.14
7 0.11
8 0.11
9 0.11
10 0.13
11 0.18
12 0.19
13 0.23
14 0.24
15 0.25
16 0.27
17 0.28
18 0.3
19 0.3
20 0.3
21 0.26
22 0.3
23 0.3
24 0.36
25 0.37
26 0.37
27 0.32
28 0.33
29 0.33
30 0.3
31 0.3
32 0.22
33 0.19
34 0.22
35 0.23
36 0.22
37 0.22
38 0.2
39 0.18
40 0.2
41 0.2
42 0.14
43 0.12
44 0.12
45 0.11
46 0.11
47 0.11
48 0.1
49 0.1
50 0.09
51 0.11
52 0.12
53 0.12
54 0.12
55 0.16
56 0.16
57 0.23
58 0.24
59 0.23
60 0.25
61 0.29
62 0.33
63 0.32
64 0.31
65 0.25
66 0.23
67 0.23
68 0.21
69 0.2
70 0.15
71 0.13
72 0.16
73 0.15
74 0.16
75 0.2
76 0.22
77 0.21
78 0.22
79 0.23
80 0.17
81 0.17
82 0.16
83 0.12
84 0.09
85 0.08
86 0.1
87 0.09
88 0.09
89 0.1
90 0.11
91 0.12
92 0.19
93 0.2
94 0.17
95 0.18
96 0.18
97 0.19
98 0.27
99 0.3
100 0.25
101 0.27
102 0.27
103 0.26
104 0.27
105 0.28
106 0.2
107 0.18
108 0.2
109 0.19
110 0.19
111 0.2
112 0.2
113 0.19
114 0.21
115 0.2
116 0.15
117 0.14
118 0.13
119 0.11
120 0.1
121 0.08
122 0.06
123 0.06
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.06
130 0.05
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.04
137 0.04
138 0.04
139 0.05
140 0.06
141 0.08
142 0.1
143 0.1
144 0.11
145 0.12
146 0.13
147 0.12
148 0.12
149 0.11
150 0.12
151 0.13
152 0.12
153 0.11
154 0.1
155 0.12
156 0.11
157 0.09
158 0.1
159 0.08
160 0.09
161 0.1
162 0.11
163 0.11
164 0.11
165 0.13
166 0.11
167 0.11
168 0.11
169 0.1
170 0.1
171 0.08
172 0.07
173 0.06
174 0.07
175 0.09
176 0.1
177 0.1
178 0.11
179 0.15
180 0.15
181 0.16
182 0.2
183 0.18
184 0.22
185 0.23
186 0.22
187 0.21
188 0.22
189 0.21
190 0.18
191 0.17
192 0.13
193 0.13
194 0.14
195 0.12
196 0.11
197 0.15
198 0.14
199 0.17
200 0.22
201 0.2
202 0.19
203 0.19
204 0.2
205 0.16
206 0.17
207 0.15
208 0.1
209 0.17
210 0.19
211 0.21
212 0.28
213 0.32
214 0.34
215 0.36
216 0.4
217 0.39
218 0.46
219 0.53
220 0.53
221 0.52
222 0.48
223 0.52
224 0.49
225 0.48
226 0.41
227 0.41
228 0.42
229 0.41
230 0.49
231 0.5
232 0.5
233 0.54
234 0.6
235 0.53
236 0.48
237 0.48
238 0.42
239 0.45
240 0.5
241 0.51
242 0.53
243 0.55
244 0.56
245 0.62
246 0.66
247 0.68
248 0.72
249 0.73
250 0.74
251 0.8
252 0.83
253 0.83
254 0.82
255 0.81
256 0.81
257 0.8
258 0.75
259 0.69
260 0.67
261 0.6
262 0.61
263 0.54
264 0.51
265 0.44
266 0.42
267 0.41
268 0.41
269 0.42
270 0.4
271 0.39
272 0.37
273 0.38
274 0.35
275 0.34
276 0.33
277 0.31
278 0.32
279 0.34
280 0.3
281 0.29
282 0.29
283 0.28
284 0.3