Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8DZP5

Protein Details
Accession S8DZP5   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
80-102GTNNLIVSRKRRRCKHGISEITAHydrophilic
NLS Segment(s)
PositionSequence
12-32PKPPTPGLRSGIRGGKRRGTR
Subcellular Location(s) mito 12, nucl 8.5, cyto_nucl 8, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MLMHSAPGYSRPKPPTPGLRSGIRGGKRRGTREEDGRTRASGWWEKGGVGVAVARDDVRWRDDRACQSRKYCIYNPKLWGTNNLIVSRKRRRCKHGISEITA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.58
3 0.59
4 0.64
5 0.61
6 0.6
7 0.58
8 0.57
9 0.57
10 0.53
11 0.53
12 0.49
13 0.52
14 0.54
15 0.56
16 0.57
17 0.57
18 0.57
19 0.59
20 0.64
21 0.61
22 0.59
23 0.55
24 0.49
25 0.43
26 0.38
27 0.34
28 0.3
29 0.26
30 0.24
31 0.22
32 0.21
33 0.2
34 0.19
35 0.14
36 0.09
37 0.08
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.06
44 0.07
45 0.1
46 0.12
47 0.14
48 0.17
49 0.23
50 0.33
51 0.4
52 0.45
53 0.47
54 0.48
55 0.53
56 0.55
57 0.56
58 0.54
59 0.54
60 0.56
61 0.58
62 0.59
63 0.58
64 0.57
65 0.51
66 0.5
67 0.47
68 0.46
69 0.44
70 0.42
71 0.41
72 0.41
73 0.49
74 0.54
75 0.57
76 0.62
77 0.67
78 0.72
79 0.78
80 0.84
81 0.86
82 0.86