Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8G7K6

Protein Details
Accession S8G7K6   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
97-125PFKGHEKKEKTEKKPKDKAKKVEKKEEAPBasic
NLS Segment(s)
PositionSequence
74-122EEKKEEKKEDRSKSPSLLAKLLAPFKGHEKKEKTEKKPKDKAKKVEKKE
189-205EKKEEKLKSPKVSRRLS
Subcellular Location(s) cyto 13.5, cyto_nucl 12, nucl 9.5, mito 2
Family & Domain DBs
Amino Acid Sequences MSDVAAPAAAPVEEVTPTEAPAAEPTPAPEAAPEAVPATTEAEEAKPAEAPAADAPATDAAAEPAATEEAKPAEEKKEEKKEDRSKSPSLLAKLLAPFKGHEKKEKTEKKPKDKAKKVEKKEEAPATEAPKDDSSAEAVAEAPKAEETPAEAAAEPVKETENAPAAEEPAVEAAPADAAETPVEAPKEEKKEEKLKSPKVSRRLSSRVGDFFKPKARAEPTTPKVEENPPKLAESEPIAPLENPAVEEAAAESTPAPAEEVKAEAPPAAPVVAAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.12
3 0.11
4 0.12
5 0.13
6 0.12
7 0.12
8 0.15
9 0.16
10 0.13
11 0.13
12 0.14
13 0.17
14 0.17
15 0.16
16 0.13
17 0.14
18 0.14
19 0.15
20 0.13
21 0.11
22 0.11
23 0.11
24 0.11
25 0.11
26 0.11
27 0.1
28 0.11
29 0.1
30 0.12
31 0.13
32 0.12
33 0.11
34 0.1
35 0.11
36 0.1
37 0.11
38 0.1
39 0.12
40 0.11
41 0.1
42 0.11
43 0.1
44 0.1
45 0.09
46 0.08
47 0.06
48 0.06
49 0.06
50 0.05
51 0.05
52 0.06
53 0.06
54 0.06
55 0.07
56 0.08
57 0.08
58 0.1
59 0.11
60 0.15
61 0.19
62 0.23
63 0.31
64 0.41
65 0.46
66 0.51
67 0.6
68 0.65
69 0.69
70 0.74
71 0.71
72 0.65
73 0.62
74 0.62
75 0.56
76 0.49
77 0.43
78 0.34
79 0.31
80 0.3
81 0.3
82 0.24
83 0.2
84 0.18
85 0.25
86 0.32
87 0.31
88 0.36
89 0.39
90 0.45
91 0.55
92 0.64
93 0.65
94 0.68
95 0.76
96 0.79
97 0.83
98 0.87
99 0.87
100 0.87
101 0.87
102 0.88
103 0.88
104 0.85
105 0.86
106 0.82
107 0.75
108 0.73
109 0.68
110 0.58
111 0.51
112 0.46
113 0.39
114 0.35
115 0.3
116 0.24
117 0.19
118 0.19
119 0.16
120 0.13
121 0.1
122 0.09
123 0.08
124 0.07
125 0.06
126 0.06
127 0.06
128 0.05
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.05
135 0.06
136 0.07
137 0.07
138 0.07
139 0.07
140 0.08
141 0.08
142 0.07
143 0.06
144 0.06
145 0.06
146 0.07
147 0.09
148 0.11
149 0.11
150 0.12
151 0.12
152 0.12
153 0.12
154 0.11
155 0.09
156 0.06
157 0.06
158 0.05
159 0.05
160 0.04
161 0.04
162 0.04
163 0.04
164 0.03
165 0.04
166 0.04
167 0.04
168 0.05
169 0.07
170 0.07
171 0.07
172 0.09
173 0.15
174 0.2
175 0.23
176 0.26
177 0.31
178 0.4
179 0.43
180 0.51
181 0.55
182 0.58
183 0.65
184 0.72
185 0.73
186 0.74
187 0.78
188 0.73
189 0.72
190 0.7
191 0.67
192 0.62
193 0.59
194 0.57
195 0.54
196 0.52
197 0.47
198 0.46
199 0.47
200 0.46
201 0.42
202 0.42
203 0.43
204 0.44
205 0.49
206 0.55
207 0.52
208 0.57
209 0.57
210 0.51
211 0.5
212 0.54
213 0.55
214 0.49
215 0.51
216 0.44
217 0.44
218 0.43
219 0.4
220 0.33
221 0.28
222 0.27
223 0.22
224 0.21
225 0.22
226 0.2
227 0.21
228 0.2
229 0.16
230 0.13
231 0.12
232 0.11
233 0.09
234 0.1
235 0.09
236 0.09
237 0.09
238 0.08
239 0.08
240 0.08
241 0.08
242 0.08
243 0.09
244 0.07
245 0.09
246 0.1
247 0.12
248 0.13
249 0.14
250 0.14
251 0.14
252 0.14
253 0.13
254 0.13
255 0.11
256 0.09