Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8E410

Protein Details
Accession S8E410   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
32-57DEPNEASPRPRKQRKPAKRVGKDITVHydrophilic
NLS Segment(s)
PositionSequence
39-52PRPRKQRKPAKRVG
Subcellular Location(s) nucl 14.5, cyto_nucl 9, mito 7, pero 3
Family & Domain DBs
Amino Acid Sequences MPSAPAYLPDELFKAAFSKAASSSKRRLDAEDEPNEASPRPRKQRKPAKRVGKDITVGSRTIRTLTPVNPAVPTTIPRAMVPPRTVNKFVKRSLNLKGKAQAAQAKGWQRRKANVGVMKRNGPAANFARNGGYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.13
4 0.12
5 0.13
6 0.16
7 0.23
8 0.28
9 0.32
10 0.39
11 0.44
12 0.5
13 0.48
14 0.48
15 0.47
16 0.51
17 0.54
18 0.51
19 0.47
20 0.42
21 0.42
22 0.4
23 0.33
24 0.3
25 0.28
26 0.32
27 0.4
28 0.49
29 0.57
30 0.67
31 0.78
32 0.84
33 0.87
34 0.88
35 0.89
36 0.87
37 0.86
38 0.8
39 0.74
40 0.65
41 0.57
42 0.51
43 0.41
44 0.34
45 0.26
46 0.22
47 0.17
48 0.16
49 0.15
50 0.13
51 0.14
52 0.14
53 0.19
54 0.19
55 0.19
56 0.18
57 0.18
58 0.16
59 0.15
60 0.15
61 0.14
62 0.14
63 0.14
64 0.14
65 0.17
66 0.18
67 0.22
68 0.23
69 0.26
70 0.28
71 0.33
72 0.38
73 0.41
74 0.47
75 0.48
76 0.5
77 0.52
78 0.52
79 0.51
80 0.56
81 0.59
82 0.54
83 0.52
84 0.53
85 0.47
86 0.45
87 0.46
88 0.42
89 0.35
90 0.34
91 0.36
92 0.4
93 0.46
94 0.52
95 0.55
96 0.53
97 0.57
98 0.6
99 0.6
100 0.61
101 0.6
102 0.62
103 0.64
104 0.65
105 0.63
106 0.58
107 0.57
108 0.49
109 0.41
110 0.4
111 0.35
112 0.37
113 0.34
114 0.34