Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8EAS9

Protein Details
Accession S8EAS9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MVPPTTTKPPPKPSAKRGKVMLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 6.5, cyto_pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
IPR018506  Cyt_B5_heme-BS  
Gene Ontology GO:0020037  F:heme binding  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
PROSITE View protein in PROSITE  
PS00191  CYTOCHROME_B5_1  
PS50255  CYTOCHROME_B5_2  
Amino Acid Sequences MVPPTTTKPPPKPSAKRGKVMLAPGHGPLDWANLKKSGQDLRGVDTLLRVTPSMLKEHRTRDDAWSAFNGKVYNVTSYLPYHPGGEKELMRVAGRDGSKLFALTHAWVNLDYMLDACLIGFLVPEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.8
4 0.76
5 0.74
6 0.68
7 0.65
8 0.59
9 0.51
10 0.45
11 0.39
12 0.36
13 0.28
14 0.24
15 0.17
16 0.18
17 0.18
18 0.18
19 0.18
20 0.19
21 0.2
22 0.2
23 0.24
24 0.24
25 0.23
26 0.27
27 0.26
28 0.28
29 0.29
30 0.28
31 0.24
32 0.19
33 0.18
34 0.13
35 0.12
36 0.08
37 0.07
38 0.1
39 0.11
40 0.15
41 0.16
42 0.19
43 0.23
44 0.28
45 0.31
46 0.31
47 0.31
48 0.3
49 0.35
50 0.31
51 0.28
52 0.25
53 0.24
54 0.21
55 0.21
56 0.18
57 0.11
58 0.14
59 0.13
60 0.12
61 0.11
62 0.11
63 0.12
64 0.13
65 0.15
66 0.15
67 0.14
68 0.15
69 0.15
70 0.16
71 0.16
72 0.18
73 0.17
74 0.17
75 0.18
76 0.18
77 0.17
78 0.17
79 0.16
80 0.17
81 0.17
82 0.17
83 0.16
84 0.16
85 0.16
86 0.17
87 0.16
88 0.12
89 0.13
90 0.14
91 0.16
92 0.15
93 0.15
94 0.15
95 0.15
96 0.14
97 0.13
98 0.11
99 0.08
100 0.08
101 0.07
102 0.06
103 0.05
104 0.05
105 0.05
106 0.04