Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8EE96

Protein Details
Accession S8EE96    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAKSTRSKVKRHFRAKKRTEGVYAHydrophilic
NLS Segment(s)
PositionSequence
7-18SKVKRHFRAKKR
106-150HGPRGSRREQWRLSKGMPARPESKGTNRQGGIAAKRKAGRSHRRR
Subcellular Location(s) nucl 14, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSTRSKVKRHFRAKKRTEGVYAVAEAARLNRLHQKLKVLTTLDKDGDVDVPEEIADSFSGEESVEQRPDGQTTGDAPAEGADAMAVDSGSAGPSTEGAKRISTHGPRGSRREQWRLSKGMPARPESKGTNRQGGIAAKRKAGRSHRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.9
3 0.91
4 0.86
5 0.81
6 0.75
7 0.67
8 0.61
9 0.52
10 0.45
11 0.35
12 0.28
13 0.22
14 0.17
15 0.14
16 0.14
17 0.11
18 0.13
19 0.19
20 0.24
21 0.29
22 0.32
23 0.39
24 0.39
25 0.42
26 0.45
27 0.4
28 0.38
29 0.37
30 0.38
31 0.31
32 0.27
33 0.24
34 0.2
35 0.18
36 0.15
37 0.12
38 0.08
39 0.07
40 0.07
41 0.07
42 0.06
43 0.05
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.04
50 0.05
51 0.06
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.09
58 0.09
59 0.08
60 0.07
61 0.08
62 0.1
63 0.09
64 0.08
65 0.08
66 0.07
67 0.07
68 0.06
69 0.05
70 0.03
71 0.03
72 0.03
73 0.03
74 0.02
75 0.02
76 0.02
77 0.02
78 0.03
79 0.03
80 0.03
81 0.03
82 0.04
83 0.06
84 0.07
85 0.1
86 0.11
87 0.12
88 0.13
89 0.17
90 0.24
91 0.26
92 0.32
93 0.37
94 0.43
95 0.47
96 0.54
97 0.56
98 0.57
99 0.62
100 0.64
101 0.65
102 0.67
103 0.68
104 0.66
105 0.62
106 0.61
107 0.58
108 0.56
109 0.53
110 0.49
111 0.47
112 0.44
113 0.48
114 0.45
115 0.5
116 0.52
117 0.52
118 0.56
119 0.52
120 0.51
121 0.51
122 0.51
123 0.51
124 0.5
125 0.48
126 0.46
127 0.5
128 0.52
129 0.56
130 0.61