Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8F3S2

Protein Details
Accession S8F3S2    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
40-65RSGLMKSTRTRKRARRNAALGNRRVHHydrophilic
NLS Segment(s)
PositionSequence
45-57KSTRTRKRARRNA
Subcellular Location(s) mito 14.5, cyto_mito 9.833, nucl 6.5, cyto_nucl 5.833, cyto 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNHPFCLPGPFPSKGKDDFFVVFVGTSLLVFATSRGRSIRSGLMKSTRTRKRARRNAALGNRRVHEEC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.34
4 0.32
5 0.29
6 0.28
7 0.24
8 0.2
9 0.16
10 0.12
11 0.11
12 0.07
13 0.05
14 0.04
15 0.04
16 0.03
17 0.03
18 0.04
19 0.07
20 0.08
21 0.09
22 0.1
23 0.11
24 0.12
25 0.15
26 0.2
27 0.22
28 0.23
29 0.25
30 0.31
31 0.34
32 0.38
33 0.46
34 0.48
35 0.5
36 0.58
37 0.65
38 0.71
39 0.77
40 0.82
41 0.83
42 0.83
43 0.87
44 0.88
45 0.87
46 0.82
47 0.78
48 0.7