Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S8G5

Protein Details
Accession F4S8G5   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
77-101SSVLVQPKKKNKKTSSQSKRKADTDHydrophilic
NLS Segment(s)
PositionSequence
84-90KKKNKKT
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
KEGG mlr:MELLADRAFT_68862  -  
Amino Acid Sequences MSSSVQGQPYTSHAAESDSGTPCRPIRTRTQVKTPGMVAQTPDSRRRITIPDEECEKANKKRKASAEYLLGNDSDASSVLVQPKKKNKKTSSQSKRKADTDAACHDDEVSTLLHLVSSVELHSNLLHALLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.22
4 0.23
5 0.2
6 0.21
7 0.21
8 0.24
9 0.23
10 0.29
11 0.29
12 0.29
13 0.35
14 0.45
15 0.55
16 0.57
17 0.66
18 0.68
19 0.67
20 0.66
21 0.57
22 0.51
23 0.43
24 0.38
25 0.29
26 0.24
27 0.28
28 0.28
29 0.32
30 0.3
31 0.29
32 0.29
33 0.3
34 0.3
35 0.29
36 0.35
37 0.32
38 0.33
39 0.36
40 0.36
41 0.34
42 0.34
43 0.34
44 0.33
45 0.4
46 0.42
47 0.41
48 0.46
49 0.51
50 0.53
51 0.53
52 0.48
53 0.45
54 0.41
55 0.39
56 0.33
57 0.27
58 0.22
59 0.17
60 0.13
61 0.07
62 0.05
63 0.05
64 0.04
65 0.06
66 0.11
67 0.14
68 0.17
69 0.23
70 0.34
71 0.44
72 0.52
73 0.61
74 0.62
75 0.69
76 0.77
77 0.82
78 0.83
79 0.84
80 0.86
81 0.85
82 0.86
83 0.77
84 0.72
85 0.68
86 0.62
87 0.57
88 0.54
89 0.49
90 0.43
91 0.4
92 0.36
93 0.28
94 0.23
95 0.17
96 0.11
97 0.07
98 0.07
99 0.07
100 0.06
101 0.06
102 0.06
103 0.06
104 0.06
105 0.07
106 0.08
107 0.09
108 0.1
109 0.1
110 0.1
111 0.09