Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8DVC6

Protein Details
Accession S8DVC6   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-45KGASPPPDLRRKPKGPRPIRRRAMPQFPRABasic
NLS Segment(s)
PositionSequence
17-38GASPPPDLRRKPKGPRPIRRRA
Subcellular Location(s) cyto 9, pero 7, mito 6, nucl 5
Family & Domain DBs
Amino Acid Sequences MSSLNQTYTNLLKWGKGASPPPDLRRKPKGPRPIRRRAMPQFPRAWIQPVGPIAHPIPHRIEAEEQAKYAAILYGDWDVVWDGVDPASEDFSAFDQGRQEKVEYTTWPPVLPKQPAPWVGFEHPTCAPGPFGAPIDVALTGAASSQGTADILPDWPPFRIPMPAPWIW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.26
4 0.3
5 0.3
6 0.39
7 0.44
8 0.5
9 0.58
10 0.61
11 0.65
12 0.69
13 0.73
14 0.74
15 0.78
16 0.81
17 0.82
18 0.87
19 0.88
20 0.89
21 0.88
22 0.85
23 0.86
24 0.83
25 0.84
26 0.8
27 0.79
28 0.73
29 0.67
30 0.63
31 0.54
32 0.49
33 0.4
34 0.32
35 0.28
36 0.25
37 0.24
38 0.21
39 0.21
40 0.18
41 0.21
42 0.21
43 0.19
44 0.2
45 0.22
46 0.22
47 0.21
48 0.23
49 0.23
50 0.26
51 0.24
52 0.21
53 0.18
54 0.17
55 0.15
56 0.14
57 0.09
58 0.05
59 0.04
60 0.05
61 0.06
62 0.06
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.04
69 0.03
70 0.03
71 0.04
72 0.04
73 0.04
74 0.05
75 0.04
76 0.04
77 0.05
78 0.05
79 0.08
80 0.08
81 0.09
82 0.11
83 0.12
84 0.14
85 0.15
86 0.15
87 0.13
88 0.16
89 0.18
90 0.17
91 0.2
92 0.24
93 0.23
94 0.23
95 0.23
96 0.25
97 0.29
98 0.3
99 0.29
100 0.28
101 0.33
102 0.38
103 0.39
104 0.36
105 0.35
106 0.34
107 0.36
108 0.32
109 0.3
110 0.25
111 0.25
112 0.23
113 0.19
114 0.17
115 0.12
116 0.13
117 0.11
118 0.12
119 0.11
120 0.11
121 0.1
122 0.11
123 0.1
124 0.09
125 0.07
126 0.06
127 0.05
128 0.05
129 0.05
130 0.04
131 0.04
132 0.04
133 0.05
134 0.05
135 0.05
136 0.06
137 0.06
138 0.07
139 0.1
140 0.12
141 0.13
142 0.14
143 0.15
144 0.17
145 0.18
146 0.23
147 0.23
148 0.28