Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8E932

Protein Details
Accession S8E932    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
55-80GAEYQPSQRKRKRKHGFLARKKSLTGHydrophilic
NLS Segment(s)
PositionSequence
63-94RKRKRKHGFLARKKSLTGRKILARRLAKGRRS
Subcellular Location(s) mito 18, nucl 8.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences PSSALRSFVATVLPRTIPSLLSRNRLLDLLQPTPSLIASSPILHAVQQVRYRTFGAEYQPSQRKRKRKHGFLARKKSLTGRKILARRLAKGRRSLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.21
4 0.17
5 0.19
6 0.26
7 0.27
8 0.31
9 0.33
10 0.32
11 0.33
12 0.32
13 0.29
14 0.26
15 0.26
16 0.24
17 0.23
18 0.21
19 0.2
20 0.2
21 0.19
22 0.13
23 0.09
24 0.08
25 0.08
26 0.08
27 0.09
28 0.09
29 0.09
30 0.09
31 0.11
32 0.1
33 0.14
34 0.17
35 0.19
36 0.19
37 0.2
38 0.21
39 0.19
40 0.19
41 0.16
42 0.16
43 0.19
44 0.2
45 0.26
46 0.33
47 0.38
48 0.46
49 0.52
50 0.58
51 0.63
52 0.73
53 0.76
54 0.78
55 0.83
56 0.86
57 0.9
58 0.91
59 0.93
60 0.9
61 0.81
62 0.73
63 0.71
64 0.68
65 0.62
66 0.57
67 0.53
68 0.54
69 0.58
70 0.63
71 0.64
72 0.6
73 0.62
74 0.66
75 0.68
76 0.66
77 0.68