Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RH63

Protein Details
Accession F4RH63    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
88-117LPQKLRVVKKSSRRPPKSRKRAVNKEGEISHydrophilic
NLS Segment(s)
PositionSequence
88-113LPQKLRVVKKSSRRPPKSRKRAVNKE
125-141VKVEPKAKSKVKGERNK
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
KEGG mlr:MELLADRAFT_61935  -  
Amino Acid Sequences MNNAKQAFESVNTSYTFDSNQLETKSCSDNGSDDLPKMEPLSKACGYMPNDPVVQSPPTEPVKDSLKLRLNIKRPAPASSPIKSVLPLPQKLRVVKKSSRRPPKSRKRAVNKEGEISVEVTKPVVKVEPKAKSKVKGERNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.19
4 0.17
5 0.17
6 0.16
7 0.2
8 0.2
9 0.21
10 0.22
11 0.24
12 0.26
13 0.24
14 0.24
15 0.2
16 0.2
17 0.21
18 0.24
19 0.22
20 0.19
21 0.19
22 0.19
23 0.18
24 0.18
25 0.18
26 0.15
27 0.15
28 0.22
29 0.2
30 0.21
31 0.21
32 0.26
33 0.27
34 0.3
35 0.3
36 0.26
37 0.26
38 0.25
39 0.25
40 0.21
41 0.18
42 0.13
43 0.12
44 0.15
45 0.17
46 0.17
47 0.17
48 0.17
49 0.21
50 0.23
51 0.24
52 0.26
53 0.3
54 0.32
55 0.37
56 0.4
57 0.42
58 0.45
59 0.46
60 0.44
61 0.39
62 0.39
63 0.37
64 0.37
65 0.37
66 0.32
67 0.32
68 0.28
69 0.27
70 0.24
71 0.23
72 0.23
73 0.25
74 0.27
75 0.28
76 0.33
77 0.37
78 0.41
79 0.48
80 0.47
81 0.48
82 0.51
83 0.59
84 0.64
85 0.7
86 0.76
87 0.78
88 0.82
89 0.86
90 0.9
91 0.91
92 0.91
93 0.91
94 0.91
95 0.93
96 0.91
97 0.9
98 0.82
99 0.76
100 0.66
101 0.57
102 0.47
103 0.38
104 0.32
105 0.22
106 0.18
107 0.14
108 0.14
109 0.13
110 0.13
111 0.16
112 0.17
113 0.23
114 0.32
115 0.42
116 0.46
117 0.55
118 0.6
119 0.62
120 0.69
121 0.72