Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8ESI8

Protein Details
Accession S8ESI8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
21-40WKLSVTRKANVRKRLKRVDSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLGAFRPTQPSFSGLLWKVPWKLSVTRKANVRKRLKRVDSVIEAVRASGVECASLTKALELPKEHEMAPRDKYTVFTRWERGYRKGIHKVPKWTRLTLRQNPTGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.28
4 0.31
5 0.3
6 0.29
7 0.3
8 0.26
9 0.32
10 0.36
11 0.45
12 0.46
13 0.48
14 0.55
15 0.63
16 0.68
17 0.7
18 0.73
19 0.72
20 0.77
21 0.82
22 0.79
23 0.76
24 0.73
25 0.69
26 0.61
27 0.56
28 0.47
29 0.38
30 0.33
31 0.25
32 0.2
33 0.14
34 0.1
35 0.07
36 0.06
37 0.04
38 0.04
39 0.05
40 0.05
41 0.06
42 0.06
43 0.05
44 0.07
45 0.08
46 0.11
47 0.11
48 0.14
49 0.16
50 0.18
51 0.18
52 0.2
53 0.22
54 0.24
55 0.27
56 0.25
57 0.24
58 0.23
59 0.26
60 0.26
61 0.29
62 0.3
63 0.3
64 0.34
65 0.38
66 0.45
67 0.47
68 0.48
69 0.5
70 0.54
71 0.58
72 0.63
73 0.65
74 0.68
75 0.7
76 0.76
77 0.77
78 0.79
79 0.75
80 0.72
81 0.73
82 0.73
83 0.77
84 0.76
85 0.75