Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8DHH5

Protein Details
Accession S8DHH5    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
211-233FVPVRSLGRRRCGRRSRSMDVEYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 10.5, cyto 8.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
IPR008271  Ser/Thr_kinase_AS  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004672  F:protein kinase activity  
GO:0006468  P:protein phosphorylation  
Pfam View protein in Pfam  
PF00069  Pkinase  
PROSITE View protein in PROSITE  
PS50011  PROTEIN_KINASE_DOM  
PS00108  PROTEIN_KINASE_ST  
Amino Acid Sequences MSKEGGHFALNVADRRLSLLADILRKEALEKHVSERSRQEEPAQAQDVFALKAITKLDVLAHLKLQHTLRLAERAATEIVKGVEGFHVIYHDLKPQNILIAADGDTVLTDFGLSSREFPRRISPPTAPPTPPSLRGNLIASTPTAATHHWMKSEAAGSMKAAKRQSAQCQRGRKEKSGIPALDRDPTTRSTKRMMAVTSWRRTLPGVSTGFVPVRSLGRRRCGRRSRSMDVEYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.22
4 0.17
5 0.13
6 0.16
7 0.18
8 0.22
9 0.23
10 0.22
11 0.21
12 0.21
13 0.22
14 0.22
15 0.23
16 0.24
17 0.25
18 0.29
19 0.36
20 0.37
21 0.4
22 0.43
23 0.43
24 0.43
25 0.43
26 0.4
27 0.41
28 0.43
29 0.46
30 0.42
31 0.37
32 0.32
33 0.32
34 0.3
35 0.22
36 0.19
37 0.12
38 0.08
39 0.11
40 0.11
41 0.11
42 0.09
43 0.09
44 0.09
45 0.14
46 0.17
47 0.15
48 0.17
49 0.18
50 0.19
51 0.23
52 0.23
53 0.21
54 0.2
55 0.21
56 0.21
57 0.23
58 0.22
59 0.2
60 0.19
61 0.18
62 0.18
63 0.15
64 0.14
65 0.11
66 0.11
67 0.09
68 0.09
69 0.07
70 0.07
71 0.07
72 0.07
73 0.06
74 0.06
75 0.06
76 0.08
77 0.08
78 0.13
79 0.14
80 0.14
81 0.15
82 0.14
83 0.14
84 0.14
85 0.13
86 0.08
87 0.08
88 0.08
89 0.07
90 0.07
91 0.06
92 0.05
93 0.05
94 0.04
95 0.03
96 0.02
97 0.02
98 0.02
99 0.04
100 0.04
101 0.07
102 0.1
103 0.14
104 0.14
105 0.16
106 0.21
107 0.24
108 0.28
109 0.3
110 0.3
111 0.35
112 0.4
113 0.43
114 0.38
115 0.35
116 0.38
117 0.36
118 0.37
119 0.31
120 0.28
121 0.26
122 0.27
123 0.27
124 0.21
125 0.19
126 0.15
127 0.13
128 0.11
129 0.1
130 0.08
131 0.07
132 0.07
133 0.09
134 0.13
135 0.14
136 0.14
137 0.16
138 0.16
139 0.17
140 0.18
141 0.16
142 0.13
143 0.12
144 0.12
145 0.18
146 0.2
147 0.23
148 0.22
149 0.23
150 0.27
151 0.32
152 0.42
153 0.46
154 0.52
155 0.55
156 0.64
157 0.68
158 0.73
159 0.73
160 0.68
161 0.64
162 0.6
163 0.6
164 0.59
165 0.55
166 0.49
167 0.48
168 0.44
169 0.43
170 0.4
171 0.34
172 0.28
173 0.3
174 0.34
175 0.33
176 0.34
177 0.34
178 0.37
179 0.4
180 0.42
181 0.4
182 0.37
183 0.44
184 0.5
185 0.51
186 0.49
187 0.46
188 0.42
189 0.41
190 0.38
191 0.32
192 0.3
193 0.27
194 0.25
195 0.26
196 0.28
197 0.28
198 0.25
199 0.22
200 0.16
201 0.2
202 0.25
203 0.31
204 0.35
205 0.44
206 0.53
207 0.6
208 0.69
209 0.74
210 0.77
211 0.81
212 0.83
213 0.81
214 0.81