Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8FJI3

Protein Details
Accession S8FJI3    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
67-89EAEPPPKKRKLPPIKKNKSSTGPBasic
NLS Segment(s)
PositionSequence
15-35PPPEPPIPKEKPPAPRIPLKR
71-84PPKKRKLPPIKKNK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MEVKEIVIRDERKLPPPEPPIPKEKPPAPRIPLKRAPSSDERAEAPTEISAAACADAPESTPLKVEEAEPPPKKRKLPPIKKNKSSTGPSTPTPTKPPTAVPTPEASTPSKSSNGPAAAATQKPATTLGASDFDLRDKSVYDQLFNRSKQTPDSGLNRKQREEERRKYLYKLRDEARARRAEEAVCDPFAHRRKHTFDLQAAHDKIVRFEEKLRAHNSIALYPNVLGAYWKDPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.49
3 0.55
4 0.61
5 0.61
6 0.61
7 0.62
8 0.62
9 0.68
10 0.67
11 0.66
12 0.67
13 0.66
14 0.71
15 0.67
16 0.71
17 0.72
18 0.73
19 0.75
20 0.71
21 0.72
22 0.65
23 0.66
24 0.63
25 0.62
26 0.57
27 0.5
28 0.46
29 0.4
30 0.38
31 0.32
32 0.25
33 0.19
34 0.15
35 0.12
36 0.1
37 0.08
38 0.07
39 0.06
40 0.06
41 0.05
42 0.05
43 0.05
44 0.06
45 0.09
46 0.1
47 0.1
48 0.11
49 0.12
50 0.12
51 0.13
52 0.14
53 0.17
54 0.22
55 0.31
56 0.35
57 0.41
58 0.48
59 0.52
60 0.56
61 0.56
62 0.62
63 0.64
64 0.7
65 0.74
66 0.78
67 0.83
68 0.87
69 0.86
70 0.82
71 0.78
72 0.72
73 0.68
74 0.64
75 0.58
76 0.5
77 0.51
78 0.47
79 0.42
80 0.42
81 0.38
82 0.32
83 0.29
84 0.31
85 0.29
86 0.31
87 0.3
88 0.26
89 0.26
90 0.26
91 0.26
92 0.25
93 0.22
94 0.2
95 0.2
96 0.2
97 0.19
98 0.18
99 0.18
100 0.19
101 0.19
102 0.16
103 0.15
104 0.15
105 0.15
106 0.14
107 0.14
108 0.11
109 0.1
110 0.1
111 0.1
112 0.09
113 0.07
114 0.07
115 0.08
116 0.09
117 0.09
118 0.1
119 0.1
120 0.1
121 0.1
122 0.1
123 0.09
124 0.08
125 0.1
126 0.14
127 0.15
128 0.16
129 0.18
130 0.24
131 0.3
132 0.3
133 0.32
134 0.29
135 0.29
136 0.3
137 0.31
138 0.29
139 0.28
140 0.35
141 0.4
142 0.46
143 0.54
144 0.55
145 0.53
146 0.54
147 0.57
148 0.6
149 0.62
150 0.63
151 0.63
152 0.68
153 0.68
154 0.68
155 0.67
156 0.65
157 0.63
158 0.61
159 0.55
160 0.57
161 0.6
162 0.62
163 0.63
164 0.61
165 0.55
166 0.51
167 0.5
168 0.41
169 0.39
170 0.38
171 0.32
172 0.26
173 0.25
174 0.23
175 0.29
176 0.36
177 0.38
178 0.36
179 0.4
180 0.46
181 0.52
182 0.58
183 0.57
184 0.56
185 0.55
186 0.57
187 0.59
188 0.54
189 0.49
190 0.45
191 0.38
192 0.33
193 0.34
194 0.3
195 0.23
196 0.26
197 0.34
198 0.37
199 0.43
200 0.46
201 0.44
202 0.43
203 0.45
204 0.43
205 0.4
206 0.37
207 0.32
208 0.29
209 0.24
210 0.25
211 0.21
212 0.18
213 0.13
214 0.12
215 0.18