Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4RZZ5

Protein Details
Accession F4RZZ5    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
24-46LEMIQRRDQNKKNQNQNHPHAIKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, mito_nucl 12, mito 7.5, cyto 3
Family & Domain DBs
KEGG mlr:MELLADRAFT_110490  -  
Amino Acid Sequences MPQKGSSQYHPKGRSPTPSTGTPLEMIQRRDQNKKNQNQNHPHAIKEKVDHTVKTPVVQLFLKTFELAVNTKEYGLDRLKKYCETIQLVAMVFCASKTLRAGYKAQISNPLVFQDCYKMNEGRKEKENYLEGKTVCLWAKLKRLRSELVAKFKKNDGFITRSSANPNILCGFPSSRFSKRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.64
3 0.65
4 0.6
5 0.58
6 0.57
7 0.52
8 0.48
9 0.39
10 0.34
11 0.33
12 0.33
13 0.33
14 0.34
15 0.4
16 0.44
17 0.52
18 0.58
19 0.61
20 0.67
21 0.73
22 0.77
23 0.78
24 0.84
25 0.84
26 0.84
27 0.84
28 0.75
29 0.69
30 0.63
31 0.57
32 0.5
33 0.43
34 0.39
35 0.35
36 0.37
37 0.34
38 0.33
39 0.37
40 0.34
41 0.32
42 0.33
43 0.26
44 0.26
45 0.25
46 0.23
47 0.17
48 0.19
49 0.18
50 0.14
51 0.14
52 0.11
53 0.13
54 0.12
55 0.12
56 0.11
57 0.11
58 0.11
59 0.11
60 0.11
61 0.13
62 0.17
63 0.22
64 0.22
65 0.25
66 0.27
67 0.27
68 0.29
69 0.28
70 0.29
71 0.27
72 0.26
73 0.24
74 0.23
75 0.22
76 0.19
77 0.17
78 0.11
79 0.07
80 0.06
81 0.06
82 0.04
83 0.05
84 0.06
85 0.08
86 0.1
87 0.12
88 0.14
89 0.17
90 0.24
91 0.25
92 0.25
93 0.3
94 0.3
95 0.29
96 0.27
97 0.25
98 0.19
99 0.18
100 0.18
101 0.14
102 0.15
103 0.16
104 0.18
105 0.21
106 0.23
107 0.32
108 0.36
109 0.37
110 0.43
111 0.46
112 0.44
113 0.47
114 0.48
115 0.43
116 0.42
117 0.43
118 0.36
119 0.33
120 0.31
121 0.29
122 0.25
123 0.25
124 0.23
125 0.23
126 0.32
127 0.37
128 0.44
129 0.47
130 0.51
131 0.5
132 0.53
133 0.58
134 0.56
135 0.61
136 0.61
137 0.57
138 0.56
139 0.59
140 0.58
141 0.5
142 0.49
143 0.44
144 0.41
145 0.4
146 0.44
147 0.4
148 0.38
149 0.41
150 0.38
151 0.37
152 0.32
153 0.33
154 0.28
155 0.27
156 0.25
157 0.24
158 0.24
159 0.22
160 0.27
161 0.3