Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8DTM2

Protein Details
Accession S8DTM2    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
3-27AWRDAPNKTTRKKLYKKYGVRWSEFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 10.166, cyto 8, cyto_nucl 7.333, nucl 4.5
Family & Domain DBs
Amino Acid Sequences AVAWRDAPNKTTRKKLYKKYGVRWSEFWRLPYWDPTKFVVIDGMHSLFLCIVQHHMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.78
3 0.81
4 0.83
5 0.87
6 0.86
7 0.87
8 0.82
9 0.77
10 0.71
11 0.66
12 0.64
13 0.56
14 0.48
15 0.4
16 0.37
17 0.34
18 0.37
19 0.35
20 0.28
21 0.29
22 0.3
23 0.31
24 0.27
25 0.26
26 0.23
27 0.19
28 0.18
29 0.18
30 0.17
31 0.15
32 0.14
33 0.14
34 0.1
35 0.1
36 0.09
37 0.07