Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8F9R3

Protein Details
Accession S8F9R3    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
35-57EMSGGDKRQAKKRKAKVDSEEEWHydrophilic
263-283EASSQGQKRKREKGLKMGVGCHydrophilic
NLS Segment(s)
PositionSequence
32-50KRKEMSGGDKRQAKKRKAK
193-232RKKALAGRVLEAAGKAKLGKGERNVRHAEHSKAAKRVREG
271-273RKR
304-323SRGGRGPRGRGVPRGRGGKR
Subcellular Location(s) nucl 14.5, cyto_nucl 10.833, mito_nucl 10.666, mito 5.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MAETDKAELLRILESRGQQFLGAFAAPVTLGKRKEMSGGDKRQAKKRKAKVDSEEEWSGISSSDESEDSVRSESEVSELSEGVRGLEQCVAENVTSLHTTSASQANVVVFSEAQAVAGPSASKSSKAQMKAFMSSKVTKLRQDVKDESESQDPDDGDDELTNAQNDALLHQLVHTRILSGSLNPELNSTPAQRKKALAGRVLEAAGKAKLGKGERNVRHAEHSKAAKRVREGLAAKQQERHEKQLEEAKQLGNYHPALKKLYEASSQGQKRKREKGLKMGVGCFKGGVLKLSKDEINSVVGGGSRGGRGPRGRGVPRGRGGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.28
4 0.27
5 0.24
6 0.23
7 0.21
8 0.18
9 0.14
10 0.11
11 0.09
12 0.08
13 0.08
14 0.09
15 0.11
16 0.15
17 0.16
18 0.19
19 0.21
20 0.22
21 0.27
22 0.31
23 0.37
24 0.42
25 0.5
26 0.55
27 0.6
28 0.65
29 0.69
30 0.74
31 0.75
32 0.75
33 0.77
34 0.8
35 0.8
36 0.85
37 0.84
38 0.83
39 0.78
40 0.74
41 0.66
42 0.55
43 0.47
44 0.37
45 0.28
46 0.19
47 0.15
48 0.09
49 0.07
50 0.09
51 0.08
52 0.09
53 0.1
54 0.1
55 0.11
56 0.12
57 0.11
58 0.1
59 0.11
60 0.1
61 0.1
62 0.11
63 0.1
64 0.1
65 0.1
66 0.1
67 0.11
68 0.11
69 0.1
70 0.1
71 0.09
72 0.1
73 0.12
74 0.12
75 0.1
76 0.11
77 0.12
78 0.1
79 0.1
80 0.1
81 0.09
82 0.09
83 0.09
84 0.08
85 0.08
86 0.08
87 0.1
88 0.13
89 0.12
90 0.12
91 0.12
92 0.12
93 0.12
94 0.12
95 0.1
96 0.06
97 0.06
98 0.07
99 0.06
100 0.06
101 0.06
102 0.06
103 0.05
104 0.06
105 0.05
106 0.04
107 0.07
108 0.07
109 0.09
110 0.09
111 0.15
112 0.2
113 0.24
114 0.26
115 0.3
116 0.32
117 0.36
118 0.36
119 0.34
120 0.32
121 0.3
122 0.32
123 0.32
124 0.32
125 0.3
126 0.34
127 0.4
128 0.41
129 0.46
130 0.46
131 0.43
132 0.45
133 0.43
134 0.4
135 0.35
136 0.31
137 0.25
138 0.24
139 0.19
140 0.15
141 0.15
142 0.12
143 0.09
144 0.08
145 0.08
146 0.06
147 0.06
148 0.06
149 0.05
150 0.04
151 0.05
152 0.05
153 0.05
154 0.06
155 0.06
156 0.06
157 0.06
158 0.09
159 0.08
160 0.09
161 0.08
162 0.08
163 0.08
164 0.1
165 0.1
166 0.08
167 0.1
168 0.1
169 0.11
170 0.11
171 0.12
172 0.1
173 0.11
174 0.13
175 0.13
176 0.2
177 0.24
178 0.27
179 0.28
180 0.29
181 0.34
182 0.38
183 0.4
184 0.37
185 0.34
186 0.32
187 0.32
188 0.31
189 0.26
190 0.2
191 0.16
192 0.11
193 0.1
194 0.08
195 0.08
196 0.11
197 0.13
198 0.17
199 0.23
200 0.34
201 0.37
202 0.43
203 0.46
204 0.43
205 0.48
206 0.48
207 0.44
208 0.41
209 0.46
210 0.44
211 0.49
212 0.52
213 0.48
214 0.47
215 0.5
216 0.46
217 0.46
218 0.43
219 0.43
220 0.48
221 0.5
222 0.49
223 0.47
224 0.49
225 0.52
226 0.54
227 0.53
228 0.49
229 0.44
230 0.47
231 0.5
232 0.49
233 0.43
234 0.42
235 0.36
236 0.33
237 0.34
238 0.31
239 0.27
240 0.25
241 0.27
242 0.27
243 0.28
244 0.28
245 0.27
246 0.29
247 0.27
248 0.29
249 0.27
250 0.28
251 0.29
252 0.37
253 0.43
254 0.48
255 0.51
256 0.57
257 0.62
258 0.68
259 0.74
260 0.75
261 0.76
262 0.79
263 0.83
264 0.82
265 0.77
266 0.74
267 0.7
268 0.61
269 0.53
270 0.42
271 0.32
272 0.27
273 0.23
274 0.21
275 0.19
276 0.2
277 0.22
278 0.26
279 0.27
280 0.25
281 0.26
282 0.24
283 0.22
284 0.2
285 0.17
286 0.14
287 0.13
288 0.13
289 0.11
290 0.11
291 0.1
292 0.12
293 0.14
294 0.2
295 0.23
296 0.28
297 0.34
298 0.42
299 0.46
300 0.53
301 0.6
302 0.63
303 0.67