Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8E3N6

Protein Details
Accession S8E3N6   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
68-91KQTVSGTKSKPKPKPRPNGTDTKSHydrophilic
NLS Segment(s)
PositionSequence
75-83KSKPKPKPR
Subcellular Location(s) nucl 13.5, cyto_nucl 12.333, cyto 8, cyto_pero 5.999, pero 2.5
Family & Domain DBs
Amino Acid Sequences MESWSSEPKSMKADELGPINDASVPDSKEHLGDAMNSPRVPEIPPTEEAEWSELVDDDDDWQPRGPPKQTVSGTKSKPKPKPRPNGTDTKSQNQKSDRHHRDIPLVQSTRKIIIAENLWIQRYYLQMGPPNETMLTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.28
4 0.25
5 0.23
6 0.21
7 0.19
8 0.17
9 0.15
10 0.14
11 0.14
12 0.14
13 0.16
14 0.16
15 0.15
16 0.15
17 0.14
18 0.11
19 0.12
20 0.15
21 0.18
22 0.21
23 0.2
24 0.2
25 0.2
26 0.2
27 0.19
28 0.19
29 0.18
30 0.19
31 0.21
32 0.25
33 0.25
34 0.25
35 0.24
36 0.22
37 0.18
38 0.14
39 0.12
40 0.08
41 0.07
42 0.07
43 0.06
44 0.07
45 0.09
46 0.09
47 0.1
48 0.1
49 0.11
50 0.13
51 0.17
52 0.17
53 0.19
54 0.21
55 0.28
56 0.3
57 0.35
58 0.38
59 0.42
60 0.44
61 0.48
62 0.53
63 0.55
64 0.61
65 0.66
66 0.72
67 0.74
68 0.81
69 0.82
70 0.84
71 0.8
72 0.82
73 0.74
74 0.73
75 0.67
76 0.65
77 0.65
78 0.58
79 0.59
80 0.54
81 0.57
82 0.57
83 0.64
84 0.62
85 0.61
86 0.63
87 0.6
88 0.62
89 0.61
90 0.57
91 0.55
92 0.5
93 0.44
94 0.43
95 0.42
96 0.36
97 0.32
98 0.27
99 0.19
100 0.21
101 0.23
102 0.22
103 0.26
104 0.26
105 0.26
106 0.26
107 0.25
108 0.22
109 0.21
110 0.22
111 0.19
112 0.21
113 0.26
114 0.29
115 0.33
116 0.33
117 0.33