Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8DZA3

Protein Details
Accession S8DZA3    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
127-146VEESSNERKQKKKKGLAAASHydrophilic
NLS Segment(s)
PositionSequence
134-141RKQKKKKG
Subcellular Location(s) mito 13, nucl 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MSNASTPAAASAPPRPQGSPPLVMSRVQRALHNLADDKFNLASDDLVSHVAWFTTGTGLDVLIEKRTTSEDDGDDDVVEAALKCIAMVDPVENWFYVCGGWTGQNNIQVVKPPVGMPSSPSKRRAVVEESSNERKQKKKKGLAAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.31
4 0.37
5 0.4
6 0.39
7 0.36
8 0.38
9 0.38
10 0.39
11 0.39
12 0.39
13 0.4
14 0.36
15 0.34
16 0.32
17 0.35
18 0.34
19 0.35
20 0.31
21 0.26
22 0.27
23 0.25
24 0.22
25 0.18
26 0.16
27 0.13
28 0.11
29 0.1
30 0.08
31 0.08
32 0.07
33 0.08
34 0.08
35 0.07
36 0.07
37 0.06
38 0.06
39 0.06
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.06
49 0.07
50 0.07
51 0.06
52 0.07
53 0.08
54 0.09
55 0.1
56 0.11
57 0.11
58 0.13
59 0.13
60 0.13
61 0.12
62 0.1
63 0.09
64 0.07
65 0.06
66 0.04
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.04
74 0.04
75 0.05
76 0.05
77 0.06
78 0.07
79 0.07
80 0.07
81 0.07
82 0.07
83 0.06
84 0.06
85 0.05
86 0.05
87 0.08
88 0.09
89 0.13
90 0.15
91 0.18
92 0.19
93 0.19
94 0.19
95 0.21
96 0.23
97 0.21
98 0.19
99 0.16
100 0.18
101 0.19
102 0.18
103 0.17
104 0.25
105 0.32
106 0.37
107 0.4
108 0.42
109 0.44
110 0.47
111 0.49
112 0.44
113 0.41
114 0.43
115 0.46
116 0.5
117 0.54
118 0.57
119 0.57
120 0.57
121 0.6
122 0.63
123 0.67
124 0.71
125 0.73
126 0.77