Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S0U9

Protein Details
Accession F4S0U9   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
62-83VEDKCWKKYKHLAPNRNQSRFTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG mlr:MELLADRAFT_57309  -  
Amino Acid Sequences MTHGFPDQNLDFMLHRLEQDQLQSATSGIEANRATAHHANSSSAKPAGSSVSCTHCKKVGHVEDKCWKKYKHLAPNRNQSRFTQAPTEEPEVPTTANYAGVDDSIPGCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.15
5 0.14
6 0.15
7 0.18
8 0.16
9 0.16
10 0.16
11 0.15
12 0.13
13 0.12
14 0.12
15 0.07
16 0.11
17 0.1
18 0.11
19 0.11
20 0.11
21 0.16
22 0.17
23 0.19
24 0.17
25 0.18
26 0.19
27 0.21
28 0.22
29 0.2
30 0.17
31 0.16
32 0.13
33 0.13
34 0.14
35 0.11
36 0.13
37 0.13
38 0.17
39 0.23
40 0.24
41 0.25
42 0.26
43 0.26
44 0.25
45 0.33
46 0.36
47 0.4
48 0.4
49 0.46
50 0.5
51 0.56
52 0.58
53 0.56
54 0.48
55 0.45
56 0.53
57 0.56
58 0.58
59 0.63
60 0.69
61 0.72
62 0.83
63 0.86
64 0.82
65 0.74
66 0.65
67 0.63
68 0.56
69 0.5
70 0.46
71 0.37
72 0.36
73 0.4
74 0.43
75 0.36
76 0.34
77 0.33
78 0.27
79 0.26
80 0.22
81 0.18
82 0.13
83 0.13
84 0.12
85 0.12
86 0.11
87 0.11
88 0.11
89 0.1