Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8DST4

Protein Details
Accession S8DST4    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
98-119GFRKKAMFRLYKKVTRRRREEDBasic
NLS Segment(s)
PositionSequence
113-115RRR
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MGGSTGQTERLGPGLPNHVVLTCGTGTRGPSGGSGLGITSSYGAKSGCRSAKRIRRSPHYERGLAYYEVELSGHTVPVVPEKFSPALAAYEIMEYLLGFRKKAMFRLYKKVTRRRREED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.21
4 0.2
5 0.19
6 0.18
7 0.18
8 0.17
9 0.12
10 0.11
11 0.11
12 0.11
13 0.12
14 0.13
15 0.14
16 0.11
17 0.11
18 0.12
19 0.11
20 0.1
21 0.09
22 0.08
23 0.07
24 0.06
25 0.06
26 0.05
27 0.05
28 0.05
29 0.06
30 0.06
31 0.06
32 0.08
33 0.14
34 0.19
35 0.21
36 0.26
37 0.34
38 0.43
39 0.51
40 0.58
41 0.59
42 0.63
43 0.69
44 0.73
45 0.73
46 0.69
47 0.62
48 0.54
49 0.51
50 0.45
51 0.37
52 0.29
53 0.19
54 0.14
55 0.12
56 0.12
57 0.08
58 0.07
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.12
65 0.13
66 0.12
67 0.12
68 0.15
69 0.16
70 0.16
71 0.16
72 0.12
73 0.12
74 0.11
75 0.12
76 0.09
77 0.09
78 0.08
79 0.07
80 0.06
81 0.05
82 0.06
83 0.13
84 0.13
85 0.13
86 0.14
87 0.21
88 0.23
89 0.29
90 0.37
91 0.39
92 0.45
93 0.56
94 0.64
95 0.66
96 0.74
97 0.79
98 0.81
99 0.82