Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q59NQ6

Protein Details
Accession Q59NQ6    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
86-106MKPGDKPKPPIRGPPPKRKRVBasic
NLS Segment(s)
PositionSequence
88-106PGDKPKPPIRGPPPKRKRV
Subcellular Location(s) nucl 15.5, cyto_nucl 12.333, cyto 8, cyto_mito 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
IPR034099  SmD3  
Gene Ontology GO:0071013  C:catalytic step 2 spliceosome  
GO:0000243  C:commitment complex  
GO:0005829  C:cytosol  
GO:0034715  C:pICln-Sm protein complex  
GO:0071014  C:post-mRNA release spliceosomal complex  
GO:0071011  C:precatalytic spliceosome  
GO:0034719  C:SMN-Sm protein complex  
GO:0097526  C:spliceosomal tri-snRNP complex  
GO:0005685  C:U1 snRNP  
GO:0005686  C:U2 snRNP  
GO:0071004  C:U2-type prespliceosome  
GO:0005687  C:U4 snRNP  
GO:0046540  C:U4/U6 x U5 tri-snRNP complex  
GO:0005682  C:U5 snRNP  
GO:0003729  F:mRNA binding  
GO:0003723  F:RNA binding  
GO:0036261  P:7-methylguanosine cap hypermethylation  
GO:0000387  P:spliceosomal snRNP assembly  
KEGG cal:CAALFM_C501510WA  -  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01721  Sm_D3  
Amino Acid Sequences MSAGIPVRLLNEAQGHIISIELINGDTYRGKLLENEDNMNLSLYEATITQGKSGKVSHMDQVFIRGSMIRFISVPDILKNAPMFFMKPGDKPKPPIRGPPPKRKRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.12
4 0.12
5 0.1
6 0.07
7 0.06
8 0.05
9 0.05
10 0.05
11 0.05
12 0.06
13 0.07
14 0.07
15 0.08
16 0.08
17 0.09
18 0.1
19 0.15
20 0.2
21 0.22
22 0.24
23 0.23
24 0.23
25 0.23
26 0.21
27 0.17
28 0.1
29 0.08
30 0.05
31 0.05
32 0.05
33 0.05
34 0.07
35 0.07
36 0.08
37 0.11
38 0.11
39 0.12
40 0.12
41 0.13
42 0.14
43 0.16
44 0.19
45 0.17
46 0.18
47 0.17
48 0.2
49 0.19
50 0.16
51 0.15
52 0.11
53 0.11
54 0.12
55 0.12
56 0.09
57 0.09
58 0.09
59 0.11
60 0.12
61 0.12
62 0.11
63 0.13
64 0.12
65 0.15
66 0.15
67 0.13
68 0.13
69 0.13
70 0.14
71 0.13
72 0.19
73 0.19
74 0.24
75 0.33
76 0.39
77 0.43
78 0.49
79 0.56
80 0.6
81 0.62
82 0.67
83 0.69
84 0.73
85 0.78
86 0.81